Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|005260
Gene name
Locationscaffold_1:1307256..1309591
Strand-
Gene length (bp)2335
Transcript length (bp)1650
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 8.5E-08 247 350
PF13489 Methyltransf_23 Methyltransferase domain 2.6E-07 240 414
PF13847 Methyltransf_31 Methyltransferase domain 3.1E-07 244 358
PF08241 Methyltransf_11 Methyltransferase domain 5.1E-05 248 352

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|005260
MHAITVALHSSTSIGPKLSQRNAFEPLGADISNMVEAQYIQEIVLRITGADAGRIFGAEEQERLVWRMVEISEDF
SQHLWSSTVANSFGPVHYNSSKTRVSIRSQVSPTPVFSQQAPLRRREITMDDDRNSDCESRSSAPVFSTCEQSAT
TATSVSDNENDTASMRSNSPAPSVMSMSSALRQALYKQEFGRNLNNYSNVYQLPADEEELDRLERQYDMLNSLFG
YKYPPPMRKILEEDNSKVQNAVLDLGSGAGNWIIDVARDFPHCEAVAVDLTPMKVMYDLTRLRPETIEESKRIPS
NLRSEVDDINLGLEHFTGQFNVVHTRLIAMGVQDYYRLIDQISDVLRPGGLIDLAEVDFVTYDRNHQLISVTDPT
PDAVTWGKPYWSHWLRAVSNVARDRLGGDVTAARHLYRWVSKHQAYEDVTYHEFWLPIIPGNYDRPPEEAEFLKE
HRMALEYDVLSFLKAGRPMLLRAGYSEQFLLGIERHEETRGSTGGDCFGELGVSDPIDLRYYTYAFFAGLLNYVV
YQVPRSQADSILYFKLSYCLSFAC*
Coding >AgabiH97|005260
ATGCACGCGATCACCGTCGCGCTGCATTCATCAACTTCTATAGGTCCCAAATTATCTCAACGAAATGCCTTCGAG
CCACTAGGTGCTGATATTTCGAATATGGTTGAAGCCCAGTACATCCAGGAGATTGTGTTACGAATAACGGGAGCC
GATGCTGGACGTATATTTGGAGCCGAGGAACAAGAGCGACTAGTCTGGCGCATGGTCGAGATTTCGGAAGACTTT
TCCCAGCATCTTTGGTCATCCACGGTGGCTAATTCATTTGGGCCAGTCCATTATAATAGCAGCAAGACACGCGTT
TCCATCCGCTCACAGGTCTCACCTACCCCCGTCTTTTCCCAGCAAGCGCCACTGCGTAGACGAGAAATCACAATG
GACGACGATCGGAACAGCGATTGTGAATCCCGATCTTCAGCCCCCGTCTTTAGCACTTGCGAGCAGTCAGCAACG
ACAGCCACCTCAGTGTCTGACAATGAGAACGATACGGCTTCTATGCGCTCCAACTCTCCCGCGCCATCAGTAATG
TCGATGAGTAGCGCCCTCAGACAGGCGCTATATAAACAAGAATTCGGACGTAACCTCAACAACTATTCGAATGTG
TATCAGTTACCCGCTGATGAAGAGGAATTGGATCGTTTGGAGCGACAATATGATATGTTGAATTCCCTCTTTGGT
TACAAATATCCGCCTCCGATGCGGAAGATCCTGGAAGAAGACAACTCCAAGGTTCAAAATGCCGTGCTAGATCTG
GGTTCTGGTGCGGGGAACTGGATAATCGATGTTGCTAGGGATTTTCCACACTGCGAAGCAGTAGCCGTGGACTTA
ACACCGATGAAGGTCATGTATGACCTGACCCGTTTAAGGCCTGAAACCATAGAAGAGTCTAAACGAATACCGTCG
AACCTCAGGAGCGAAGTGGACGATATCAATCTCGGATTAGAGCATTTCACTGGTCAATTCAATGTTGTCCACACT
CGTCTCATAGCGATGGGAGTTCAAGATTATTACAGACTCATTGATCAAATTTCCGATGTTCTTCGACCAGGTGGA
CTAATCGACCTCGCCGAGGTCGACTTTGTAACCTACGATAGGAATCATCAACTCATTTCTGTGACCGACCCAACT
CCTGATGCTGTCACCTGGGGCAAACCTTACTGGTCGCATTGGCTGCGTGCAGTATCGAATGTCGCGAGAGATCGA
CTCGGAGGGGACGTGACAGCTGCAAGGCACTTATACAGATGGGTTAGCAAACATCAAGCTTATGAGGATGTAACC
TATCATGAGTTCTGGCTACCAATCATTCCTGGAAATTATGATCGCCCTCCGGAGGAGGCGGAGTTTCTGAAAGAA
CATCGCATGGCATTGGAATACGACGTACTCAGTTTCCTAAAAGCGGGGAGGCCAATGTTGCTCCGCGCTGGTTAT
TCCGAACAGTTCCTGCTGGGCATTGAACGCCATGAAGAAACACGTGGTTCTACCGGTGGTGACTGCTTTGGCGAG
TTAGGCGTTTCCGACCCGATTGATCTTCGCTACTATACTTATGCTTTTTTTGCTGGTCTGCTTAACTATGTTGTA
TACCAGGTACCCAGGTCCCAGGCTGATTCCATTCTATACTTTAAGTTATCTTATTGCCTTTCCTTCGCTTGTTAG
Transcript >AgabiH97|005260
ATGCACGCGATCACCGTCGCGCTGCATTCATCAACTTCTATAGGTCCCAAATTATCTCAACGAAATGCCTTCGAG
CCACTAGGTGCTGATATTTCGAATATGGTTGAAGCCCAGTACATCCAGGAGATTGTGTTACGAATAACGGGAGCC
GATGCTGGACGTATATTTGGAGCCGAGGAACAAGAGCGACTAGTCTGGCGCATGGTCGAGATTTCGGAAGACTTT
TCCCAGCATCTTTGGTCATCCACGGTGGCTAATTCATTTGGGCCAGTCCATTATAATAGCAGCAAGACACGCGTT
TCCATCCGCTCACAGGTCTCACCTACCCCCGTCTTTTCCCAGCAAGCGCCACTGCGTAGACGAGAAATCACAATG
GACGACGATCGGAACAGCGATTGTGAATCCCGATCTTCAGCCCCCGTCTTTAGCACTTGCGAGCAGTCAGCAACG
ACAGCCACCTCAGTGTCTGACAATGAGAACGATACGGCTTCTATGCGCTCCAACTCTCCCGCGCCATCAGTAATG
TCGATGAGTAGCGCCCTCAGACAGGCGCTATATAAACAAGAATTCGGACGTAACCTCAACAACTATTCGAATGTG
TATCAGTTACCCGCTGATGAAGAGGAATTGGATCGTTTGGAGCGACAATATGATATGTTGAATTCCCTCTTTGGT
TACAAATATCCGCCTCCGATGCGGAAGATCCTGGAAGAAGACAACTCCAAGGTTCAAAATGCCGTGCTAGATCTG
GGTTCTGGTGCGGGGAACTGGATAATCGATGTTGCTAGGGATTTTCCACACTGCGAAGCAGTAGCCGTGGACTTA
ACACCGATGAAGGTCATGTATGACCTGACCCGTTTAAGGCCTGAAACCATAGAAGAGTCTAAACGAATACCGTCG
AACCTCAGGAGCGAAGTGGACGATATCAATCTCGGATTAGAGCATTTCACTGGTCAATTCAATGTTGTCCACACT
CGTCTCATAGCGATGGGAGTTCAAGATTATTACAGACTCATTGATCAAATTTCCGATGTTCTTCGACCAGGTGGA
CTAATCGACCTCGCCGAGGTCGACTTTGTAACCTACGATAGGAATCATCAACTCATTTCTGTGACCGACCCAACT
CCTGATGCTGTCACCTGGGGCAAACCTTACTGGTCGCATTGGCTGCGTGCAGTATCGAATGTCGCGAGAGATCGA
CTCGGAGGGGACGTGACAGCTGCAAGGCACTTATACAGATGGGTTAGCAAACATCAAGCTTATGAGGATGTAACC
TATCATGAGTTCTGGCTACCAATCATTCCTGGAAATTATGATCGCCCTCCGGAGGAGGCGGAGTTTCTGAAAGAA
CATCGCATGGCATTGGAATACGACGTACTCAGTTTCCTAAAAGCGGGGAGGCCAATGTTGCTCCGCGCTGGTTAT
TCCGAACAGTTCCTGCTGGGCATTGAACGCCATGAAGAAACACGTGGTTCTACCGGTGGTGACTGCTTTGGCGAG
TTAGGCGTTTCCGACCCGATTGATCTTCGCTACTATACTTATGCTTTTTTTGCTGGTCTGCTTAACTATGTTGTA
TACCAGGTACCCAGGTCCCAGGCTGATTCCATTCTATACTTTAAGTTATCTTATTGCCTTTCCTTCGCTTGTTAG
Gene >AgabiH97|005260
ATGCACGCGATCACCGTCGCGCTGCATTCATCAACTTCTATAGGTCCCAAATTATCTCAACGAAGTTGACAAGAT
CTATTCAAATTGGGCAGTATAGAATATCGTGTGGGGTGTAAACAGAATGAATGGCCGTAGAGGGTATATGCACAT
AAGATGCCTTCGAGGTAAGGGGTGTTGATTCGTCGAATGACGCGGCTTTCTCAACTATTTTGCCAGCCACTAGGT
GCTGATATTTCGAATATGGTTGAAGGTGGAGAGTTGTTGTCCACCTATCTTCGTCGGACATGTCGCTGAACGGTT
CAAAGCCCAGTACATCCAGGAGATTGTGTTACGAATAACGGGAGCCGGTGATTGCTGGGCACGGTCGCATGATGG
TCTGCCTACCCTCAGCAGATGCTGGACGTATATTTGGAGCCGAGGAACAAGAGCGACTAGTCTGGCGCATGGTCG
AGATTTCGGAAGACTTTTCCCAGCATCGTGAATGCCGCTGTTTAGTTTTGCTCGGACGGGGCGCTAATATCCGCC
GTCAAAGTTTGGTCATCCACGGTGGCTAATTCATTTGGGCCAGTCCATTATAATAGCAGCAAGACACGCGTTTCC
ATCCGCTCACAGGTCTCACCTACCCCCGTCTTTTCCCAGCAAGCGCCACTGCGTAGACGAGAAATCACAATGGAC
GACGATCGGAACAGCGATTGTGAATCCCGATCTTCAGCCCCCGTCTTTAGCACTTGCGAGCAGTCAGCAACGACA
GCCACCTCAGTGTCTGACAATGAGAACGATACGGCTTCTATGCGCTCCAACTCTCCCGCGCCATCAGTAATGTCG
ATGAGTAGCGCCCTCAGACAGGCGCTATATAAACAAGAATTCGGACGTAACCTCAACAACTATTCGAATGTGTAT
CAGTTACCCGCTGATGAAGAGGAATTGGATCGTTTGGGTGAGTTTGTGCACCGTATATTTGTCATTTTCTAATTT
TGTCCATTTCATCTTATCCAGAGCGACAATATGATATGTTGAATTCCCTCTTTGGTTACAAATATCCGCCTCCGA
TGCGGAAGATCCTGGAAGAAGACAACTCCAAGGTTCAAAATGCCGTGCTAGATCTGGGTTCTGGTGCGGGGAACT
GGTATTTGCTAGCCGTTTCGTCGTCATCCTCCAGAGAGCTTACATCCATAAGGATAATCGATGTTGCTAGGGATT
TTCCACACTGCGAAGCAGTAGCCGTGGACTTAACACCGATGAAGGTCATGTATGACCTGACCCGTTTAAGGCCTG
AAACCATAGAAGAGTCTAAACGAATACCGTCGAACCTCAGGTGAGTAAAGAATTGTCCTGCTCGTGTCCAGATTG
GAACAACTTTTAACAGGAGCGAAGTGGACGATATCAATCTCGGATTAGAGCATTTCACTGGTCAATTCAATGTTG
TCCACACTCGTCTCATAGCGATGGGAGTAAGTATGGTTCCGTGTCTTGCAACTCACTGAGATATTGATTTTCCTC
CAAGGTTCAAGATTATTACAGACTCATTGATCAAATTTCCGATGTTCTTCGACCAGGTGGACTAATCGACCTCGC
CGAGGTCGACTTTGTAACCTACGATAGGAATCATCAACTCATTTCTGTGACCGACCCAACTCCTGATGCTGTCAC
CTGGGGCAAACCTTACTGGTCGCATTGGCTGCGTGCAGTATCGAATGTCGCGAGAGATCGACTCGGAGGGGACGT
GACAGCTGCAAGGCACTTATACAGATGGGTTAGCAAACATCAAGCTTATGAGGATGTAACCTATCATGAGTTCTG
GCTACCAATCATTCCTGGAAATTATGATCGCCCTCCGGAGGAGGCGGAGTTTCTGAAAGAACATCGCATGGCATT
GGAATACGACGTACTCGTATGTTGATGTCATCAAACTAGAGTCATTGGCATAGTTGACCAGGTTCTAGAGTTTCC
TAAAAGCGGGGAGGCCAATGTTGCTCCGCGCTGGTTATTCCGAACAGTTCCTGCTGGGCATTGAACGCCATGTAT
TTGAAGAATTGCGAGAAGCGGAAGAGCCTCAATATGCGCGAATAGAAACCGTCTACGCTAGGAAGAAACACGTGG
TTCTACCGGTGGTGACTGCTTTGGCGAGTTAGGCGTTTCCGACCCGGTATGCGAGTTTCTTCAGCCTTGATGGGT
CCGTGTTTGTGATGTTACAGCACTGCAGATTGATCTTCGCTACTATACTTATGCTTTTTTTGCTGGTCTGCTTAA
CTATGTTGTATACCAGGTACCCAGGTCCCAGGCTGATTCCATTCTATACTTTAAGTTATCTTATTGCCTTTCCTT
CGCTTGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail