Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|004920
Gene name
Locationscaffold_1:1214997..1215611
Strand-
Gene length (bp)614
Transcript length (bp)516
Coding sequence length (bp)516
Protein length (aa) 172

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10280 Med11 Mediator complex protein 6.8E-11 21 105

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016592 mediator complex Yes
GO:0006357 regulation of transcription by RNA polymerase II Yes
GO:0003712 transcription coregulator activity Yes
GO:0140513 nuclear protein-containing complex No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0080090 regulation of primary metabolic process No
GO:0065007 biological regulation No
GO:0005575 cellular_component No
GO:0009889 regulation of biosynthetic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0008150 biological_process No
GO:0019222 regulation of metabolic process No
GO:0140110 transcription regulator activity No
GO:2001141 regulation of RNA biosynthetic process No
GO:0006355 regulation of transcription, DNA-templated No
GO:0060255 regulation of macromolecule metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0031323 regulation of cellular metabolic process No
GO:0003674 molecular_function No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0032991 protein-containing complex No
GO:0010468 regulation of gene expression No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|004920
MDHEQPSNIDPIWTTSRTARQIYALGQVEKDITRLLSLAASSISLLSLPQTDTPEDNLPPGEERSEQFVLEVSEY
FERLDAVQVALRSSLAHIRHSRIAPSAINAPQPSFIPPSLGVGLPPETDGNSRVNRGLQEERVERDAWKGILEAL
RRLKENSRDTGLAEAQHASLQ*
Coding >AgabiH97|004920
ATGGACCACGAGCAGCCATCCAATATCGACCCGATATGGACCACTAGTCGAACTGCTCGGCAGATTTATGCTCTC
GGTCAGGTAGAAAAGGACATCACCCGCCTCCTCTCGCTCGCGGCCTCCTCCATCTCCCTTCTCTCCCTTCCCCAA
ACAGACACGCCGGAGGACAACCTTCCACCGGGTGAAGAACGGTCCGAACAATTCGTTCTCGAAGTCAGCGAATAT
TTTGAACGCCTTGACGCCGTCCAAGTCGCTTTGCGATCATCATTAGCGCATATCCGACATTCTCGCATAGCACCC
TCAGCGATCAATGCCCCGCAACCCAGTTTCATCCCGCCTTCTCTTGGTGTCGGTCTCCCACCTGAAACAGACGGA
AATTCGCGCGTGAACCGCGGTTTGCAAGAAGAGAGGGTTGAAAGGGATGCATGGAAGGGTATTTTGGAGGCACTG
AGGCGGCTAAAAGAAAATTCGCGAGATACGGGATTGGCAGAAGCGCAGCATGCATCCTTACAATAG
Transcript >AgabiH97|004920
ATGGACCACGAGCAGCCATCCAATATCGACCCGATATGGACCACTAGTCGAACTGCTCGGCAGATTTATGCTCTC
GGTCAGGTAGAAAAGGACATCACCCGCCTCCTCTCGCTCGCGGCCTCCTCCATCTCCCTTCTCTCCCTTCCCCAA
ACAGACACGCCGGAGGACAACCTTCCACCGGGTGAAGAACGGTCCGAACAATTCGTTCTCGAAGTCAGCGAATAT
TTTGAACGCCTTGACGCCGTCCAAGTCGCTTTGCGATCATCATTAGCGCATATCCGACATTCTCGCATAGCACCC
TCAGCGATCAATGCCCCGCAACCCAGTTTCATCCCGCCTTCTCTTGGTGTCGGTCTCCCACCTGAAACAGACGGA
AATTCGCGCGTGAACCGCGGTTTGCAAGAAGAGAGGGTTGAAAGGGATGCATGGAAGGGTATTTTGGAGGCACTG
AGGCGGCTAAAAGAAAATTCGCGAGATACGGGATTGGCAGAAGCGCAGCATGCATCCTTACAATAG
Gene >AgabiH97|004920
ATGGACCACGAGCAGCCATCCAATATCGACCCGATATGGACCACTAGTCGAACTGCTCGGCAGATTTATGCTCTC
GGTCAGGTAGAAAAGGTATACAACCGTCCTAGCCTTCCCGTAGCATTGCCAACACTCACCTCCAGGACATCACCC
GCCTCCTCTCGCTCGCGGCCTCCTCCATCTCCCTTCTCTCCCTTCCCCAAACAGACACGCCGGAGGACAACCTTC
CACCGGGTGAAGAACGGTCCGAACAATTCGTTCTCGAAGTCAGCGAATATTTTGAACGCCTTGACGTTAGTCCAT
TGCTCTTATCCTAGCCGGAGCTCATGACAACCGCGTAGGCCGTCCAAGTCGCTTTGCGATCATCATTAGCGCATA
TCCGACATTCTCGCATAGCACCCTCAGCGATCAATGCCCCGCAACCCAGTTTCATCCCGCCTTCTCTTGGTGTCG
GTCTCCCACCTGAAACAGACGGAAATTCGCGCGTGAACCGCGGTTTGCAAGAAGAGAGGGTTGAAAGGGATGCAT
GGAAGGGTATTTTGGAGGCACTGAGGCGGCTAAAAGAAAATTCGCGAGATACGGGATTGGCAGAAGCGCAGCATG
CATCCTTACAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail