Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|004900
Gene name
Locationscaffold_1:1211489..1212906
Strand+
Gene length (bp)1417
Transcript length (bp)1107
Coding sequence length (bp)1107
Protein length (aa) 369

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00010 HLH Helix-loop-helix DNA-binding domain 7.7E-10 273 322

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5401 0.8497 0.0423 0.029 0.3031 0.0006 0.0673 0.1103 0.0472 0.0105

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup762
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|004870
Agaricus bisporus var bisporus H39 AgabiH39|004900
Agaricus bisporus var bisporus H97 AgabiH97|004870
Agaricus bisporus var bisporus H97 AgabiH97|004900 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|38_30

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|004900
MMIWERRKLESPVQPHGARSLNPSAQSNAYITPLIPFLPLHPSSRLFSPLRPVRFLQLSSTSPNSLARFCMSSSQ
LLSLDFETKAPSYMDSMDPSFSYMENGGLEYLQYPPQSPTTFELSVGLPSSSPLAFNNALTLSGEYTYSPSFNTA
SPERSYTPPEGPSLSPPALSYNLSGGDVVPEVPSGRHSRNSSAGSAAGVSYAATVPRSHRFNPIGVAANRPTLRA
RRRSSKTSDDGHIEAAGLDAEEEDDEEFQPPPLANSQANNDARRETIRKQRIESEQRRRDELRDGYTRLKENLPT
SNQKSSKVSLLDRATSHIRYLETVKEQLEMRLKAAETEVHRLRGLNETLMLNSAQRQIAGPSSLASQF*
Coding >AgabiH97|004900
ATGATGATTTGGGAACGGCGAAAGCTGGAATCGCCGGTGCAGCCTCATGGCGCGCGGAGTCTGAATCCATCGGCC
CAAAGTAATGCTTATATAACTCCCCTCATTCCCTTCCTTCCCCTCCATCCCTCCTCCCGCCTCTTTTCCCCTCTC
CGTCCCGTCAGGTTCCTTCAGCTATCTTCCACGAGCCCAAACTCCCTAGCTCGTTTCTGCATGTCTTCCTCCCAA
CTTCTGTCTCTCGACTTTGAGACCAAGGCCCCGTCCTACATGGACTCCATGGACCCCTCTTTTTCCTACATGGAA
AACGGTGGCCTCGAGTATCTCCAGTACCCTCCCCAGTCTCCTACTACCTTCGAGCTCTCTGTTGGTCTTCCATCT
TCCTCACCCCTCGCATTTAACAATGCATTGACTCTGTCAGGGGAATATACATACTCGCCTTCTTTCAATACTGCG
TCTCCGGAACGTTCATATACACCTCCCGAGGGACCCAGCCTCTCTCCTCCCGCTCTGTCGTACAATCTCAGTGGC
GGTGATGTTGTCCCAGAGGTACCCTCAGGCCGGCATTCACGCAACAGTAGCGCTGGCTCTGCCGCCGGCGTTTCT
TATGCCGCCACTGTTCCGCGCTCTCACCGTTTCAACCCTATCGGTGTTGCCGCCAACCGCCCTACACTTAGAGCC
CGCAGAAGAAGCAGCAAGACCTCCGACGATGGCCACATTGAAGCAGCTGGCCTCGACGCCGAGGAAGAAGACGAC
GAGGAATTCCAACCGCCACCTCTTGCCAACAGTCAGGCTAACAATGATGCGCGTCGCGAAACTATCAGGAAGCAA
CGCATCGAGTCTGAGCAAAGGAGACGTGACGAGCTTCGCGATGGGTACACTCGCCTCAAAGAAAACCTCCCTACC
TCCAACCAGAAGTCAAGCAAAGTCTCGCTGCTTGATCGAGCTACCAGTCACATCAGGTATCTTGAAACTGTCAAG
GAGCAGCTCGAGATGAGGTTGAAGGCTGCTGAAACCGAAGTCCACCGACTCCGTGGCTTAAATGAGACTCTCATG
CTAAATTCAGCCCAACGTCAGATTGCTGGTCCTTCCAGCCTCGCTTCTCAATTCTGA
Transcript >AgabiH97|004900
ATGATGATTTGGGAACGGCGAAAGCTGGAATCGCCGGTGCAGCCTCATGGCGCGCGGAGTCTGAATCCATCGGCC
CAAAGTAATGCTTATATAACTCCCCTCATTCCCTTCCTTCCCCTCCATCCCTCCTCCCGCCTCTTTTCCCCTCTC
CGTCCCGTCAGGTTCCTTCAGCTATCTTCCACGAGCCCAAACTCCCTAGCTCGTTTCTGCATGTCTTCCTCCCAA
CTTCTGTCTCTCGACTTTGAGACCAAGGCCCCGTCCTACATGGACTCCATGGACCCCTCTTTTTCCTACATGGAA
AACGGTGGCCTCGAGTATCTCCAGTACCCTCCCCAGTCTCCTACTACCTTCGAGCTCTCTGTTGGTCTTCCATCT
TCCTCACCCCTCGCATTTAACAATGCATTGACTCTGTCAGGGGAATATACATACTCGCCTTCTTTCAATACTGCG
TCTCCGGAACGTTCATATACACCTCCCGAGGGACCCAGCCTCTCTCCTCCCGCTCTGTCGTACAATCTCAGTGGC
GGTGATGTTGTCCCAGAGGTACCCTCAGGCCGGCATTCACGCAACAGTAGCGCTGGCTCTGCCGCCGGCGTTTCT
TATGCCGCCACTGTTCCGCGCTCTCACCGTTTCAACCCTATCGGTGTTGCCGCCAACCGCCCTACACTTAGAGCC
CGCAGAAGAAGCAGCAAGACCTCCGACGATGGCCACATTGAAGCAGCTGGCCTCGACGCCGAGGAAGAAGACGAC
GAGGAATTCCAACCGCCACCTCTTGCCAACAGTCAGGCTAACAATGATGCGCGTCGCGAAACTATCAGGAAGCAA
CGCATCGAGTCTGAGCAAAGGAGACGTGACGAGCTTCGCGATGGGTACACTCGCCTCAAAGAAAACCTCCCTACC
TCCAACCAGAAGTCAAGCAAAGTCTCGCTGCTTGATCGAGCTACCAGTCACATCAGGTATCTTGAAACTGTCAAG
GAGCAGCTCGAGATGAGGTTGAAGGCTGCTGAAACCGAAGTCCACCGACTCCGTGGCTTAAATGAGACTCTCATG
CTAAATTCAGCCCAACGTCAGATTGCTGGTCCTTCCAGCCTCGCTTCTCAATTCTGA
Gene >AgabiH97|004900
ATGATGGTGCCGAGCGGAGGCAGTTGTTTCTAAAAGCTAGACAGGTCAAGACTGAATAAGATTTGGGAACGGCGA
AAGCTGGAATCGCCGGTGCAGCCTCATGGCGCGCGGAGTCTGAATCCATCGGCCCAAAGTAATGCTTATATAACT
CCCCTCATTCCCTTCCTTCCCCTCCATCCCTCCTCCCGCCTCTTTTCCCCTCTCCGTCCCGTCAGGTTCCTTCAG
CTATCTTCCACGAGCCCAAAGTGTGTTTGCCCCTTTCCCTTCTTTCCTTATCTCATCCGTCCCACAGCTCCCTAG
CTCGTTTCTGGTCTTTTGTTTCTCTTTGTTCTTTTTTTTTCTTTCAAGTCTCTTCAGCATGTCTTCCTCCCAACT
TCTGTCTCTCGACTTTGAGACCAAGGCCCCGTCCTACATGGACTCCATGGACCCCTCTTTTTCCTACATGGAAAA
CGGTGGCCTCGAGTATCTCCAGTACCCTCCCCAGTCTCCTACTACCTTCGAGCTCTCTGTTGGTCGTGAGTGCTG
TTTCTCAATAATCGGTTTGTATCTCCCACTGAGCCTTTTTGTTTTAGTTCCATCTTCCTCACCCCTCGCATTTAA
CAATGCATTGACTCTGTCAGGGGAATATACATACTCGCCTTCTTTCAATACTGCGTCTCCGGAACGTTCATATAC
ACCTCCCGAGGGACCCAGCCTCTCTCCTCCCGCTCTGTCGTACAATCTCAGTGGCGGTGATGTTGTCCCAGAGGT
ACCCTCAGGCCGGCATTCACGCAACAGTAGCGCTGGCTCTGCCGCCGGCGTTTCTTATGCCGCCACTGTTCCGCG
CTCTCACCGTTTCAACCCTATCGGTGTTGCCGCCAACCGCCCTACACTTAGAGCCCGCAGAAGAAGCAGCAAGAC
CTCCGACGATGGCCACATTGAAGCAGCTGGCCTCGACGCCGAGGAAGAAGACGACGAGGAATTCCAACCGCCACC
TCTTGCCAACAGTCAGGCTAACAATGATGCGTATGTCTCCTTGTTCTTTATTTCATTTGTTATGTGTTAATAAGT
GACTGTAGGCGTCGCGAAACTATCAGGAAGCAACGCATCGAGTCTGAGCAAAGGAGACGTGACGAGCTTCGCGAT
GGGTACACTCGCCTCAAAGAAAACCTCCCTACCTCCAACCAGAAGTCAAGCAAAGTCTCGCTGCTTGATCGAGGT
TAGTATTGCATAACTATTATGCTTGGCGACGCTAACGTGAGATTTTCTAGCTACCAGTCACATCAGGTATCTTGA
AACTGTCAAGGAGCAGCTCGAGATGAGGTTGAAGGCTGCTGAAACCGAAGTCCACCGACTCCGTGGCTTAAATGA
GACTCTCATGCTAAATTCAGCCCAACGTCAGATTGCTGGTCCTTCCAGCCTCGCTTCTCAATTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail