Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|004850
Gene name
Locationscaffold_1:1197593..1201153
Strand+
Gene length (bp)3560
Transcript length (bp)2538
Coding sequence length (bp)2538
Protein length (aa) 846

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01644 Chitin_synth_1 Chitin synthase 6.4E-71 173 332
PF08407 Chitin_synth_1N Chitin synthase N-terminal 1.5E-26 104 172
PF03142 Chitin_synth_2 Chitin synthase 1.7E-21 310 500

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30600|CHS1_EXODE Chitin synthase 1 OS=Exophiala dermatitidis GN=CHS1 PE=3 SV=2 132 843 0.0E+00
sp|P30599|CHS2_USTMA Chitin synthase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS2 PE=3 SV=2 92 844 0.0E+00
sp|P08004|CHS1_YEAST Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS1 PE=1 SV=2 95 842 0.0E+00
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 37 838 0.0E+00
sp|P54267|CHSG_ASPFU Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsG PE=2 SV=2 98 838 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30600|CHS1_EXODE Chitin synthase 1 OS=Exophiala dermatitidis GN=CHS1 PE=3 SV=2 132 843 0.0E+00
sp|P30599|CHS2_USTMA Chitin synthase 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS2 PE=3 SV=2 92 844 0.0E+00
sp|P08004|CHS1_YEAST Chitin synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS1 PE=1 SV=2 95 842 0.0E+00
sp|Q00757|CHSB_EMENI Chitin synthase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsB PE=2 SV=2 37 838 0.0E+00
sp|P54267|CHSG_ASPFU Chitin synthase G OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsG PE=2 SV=2 98 838 0.0E+00
sp|Q92197|CHSC_ASPFU Chitin synthase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=chsC PE=3 SV=2 98 845 0.0E+00
sp|P29070|CHS1_NEUCR Chitin synthase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-1 PE=3 SV=2 98 845 0.0E+00
sp|P30602|CHS3_EXODE Chitin synthase 3 OS=Exophiala dermatitidis GN=CHS3 PE=3 SV=2 12 794 0.0E+00
sp|P23316|CHS1_CANAX Chitin synthase 1 OS=Candida albicans GN=CHS1 PE=2 SV=2 87 839 0.0E+00
sp|P30572|CHS2_CANAX Chitin synthase 2 OS=Candida albicans GN=CHS2 PE=2 SV=2 85 842 0.0E+00
sp|P14180|CHS2_YEAST Chitin synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS2 PE=1 SV=1 113 843 0.0E+00
sp|P30588|CHS3_NEUCR Chitin synthase 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-3 PE=3 SV=2 5 842 0.0E+00
sp|Q92444|CHS2_PARBR Chitin synthase 2 OS=Paracoccidioides brasiliensis GN=CHS2 PE=3 SV=2 85 843 0.0E+00
sp|Q99127|CHS4_USTMA Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS4 PE=3 SV=2 99 842 0.0E+00
sp|P87073|CHS1_PHYB8 Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=chs1 PE=3 SV=1 74 842 0.0E+00
sp|P30594|CHS1_RHIOL Chitin synthase 1 OS=Rhizopus oligosporus GN=CHS1 PE=3 SV=1 78 842 0.0E+00
sp|P30595|CHS2_RHIOL Chitin synthase 2 OS=Rhizopus oligosporus GN=CHS2 PE=3 SV=1 66 842 0.0E+00
sp|Q12632|CHS1_MUCCL Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus GN=CHS1 PE=3 SV=1 92 840 0.0E+00
sp|Q12564|CHSA_AMPQU Chitin synthase A OS=Ampelomyces quisqualis GN=CHSA PE=3 SV=1 98 845 0.0E+00
sp|Q99126|CHS3_USTMA Chitin synthase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS3 PE=3 SV=2 86 843 0.0E+00
sp|P30601|CHS2_EXODE Chitin synthase 2 OS=Exophiala dermatitidis GN=CHS2 PE=3 SV=2 101 844 0.0E+00
sp|P30589|CHS2_NEUCR Chitin synthase 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-2 PE=3 SV=4 4 843 0.0E+00
sp|P30583|CHSC_EMENI Chitin synthase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsC PE=3 SV=3 3 842 0.0E+00
sp|P30597|CHS1_SCHPO Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs1 PE=3 SV=2 86 842 0.0E+00
sp|P30584|CHSA_EMENI Chitin synthase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsA PE=3 SV=2 77 843 0.0E+00
sp|P30598|CHS1_USTMA Chitin synthase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS1 PE=3 SV=3 87 841 1.0E-180
sp|O74756|CHS2_SCHPO Chitin synthase-like protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chs2 PE=3 SV=1 78 844 6.0E-116
sp|P48017|CHS_SAPMO Chitin synthase OS=Saprolegnia monoica GN=CHS PE=3 SV=1 132 759 8.0E-112
sp|P30596|CHS1_SCHCO Chitin synthase 1 (Fragment) OS=Schizophyllum commune GN=CHS1 PE=3 SV=1 178 364 1.0E-75
sp|P30591|CHS2_EXOEX Chitin synthase 2 (Fragment) OS=Exophiala exophialae GN=CHS2 PE=3 SV=2 178 364 1.0E-66
sp|P30586|CHS2_EXOJE Chitin synthase 2 (Fragment) OS=Exophiala jeanselmei GN=CHS2 PE=3 SV=2 178 363 4.0E-66
sp|P30590|CHS1_EXOEX Chitin synthase 1 (Fragment) OS=Exophiala exophialae GN=CHS1 PE=3 SV=1 178 364 6.0E-66
sp|P30582|CHS2_ASPNG Chitin synthase 2 (Fragment) OS=Aspergillus niger GN=chs2 PE=3 SV=1 178 364 6.0E-66
sp|P30585|CHS1_EXOJE Chitin synthase 1 (Fragment) OS=Exophiala jeanselmei GN=CHS1 PE=3 SV=1 178 364 1.0E-65
sp|P30581|CHS1_ASPNG Chitin synthase 1 (Fragment) OS=Aspergillus niger GN=chs1 PE=3 SV=1 178 364 1.0E-65
sp|P30579|CHS1_AJEDE Chitin synthase 1 (Fragment) OS=Ajellomyces dermatitidis GN=CHS1 PE=3 SV=1 179 364 2.0E-65
sp|P30592|CHS1_RHIAT Chitin synthase 1 (Fragment) OS=Rhinocladiella atrovirens GN=CHS1 PE=3 SV=1 178 364 8.0E-65
sp|P49603|CHS1_BOTFU Chitin synthase 1 (Fragment) OS=Botryotinia fuckeliana GN=chs1 PE=3 SV=1 178 364 5.0E-64
sp|P30576|CHS1_AJECA Chitin synthase 1 (Fragment) OS=Ajellomyces capsulatus GN=CHS1 PE=3 SV=1 178 345 1.0E-63
sp|P30580|CHS2_AJEDE Chitin synthase 2 (Fragment) OS=Ajellomyces dermatitidis GN=CHS2 PE=3 SV=1 178 364 2.0E-63
sp|P30603|CHS1_XYLBA Chitin synthase 1 (Fragment) OS=Xylohypha bantiana GN=CHS1 PE=3 SV=1 178 364 2.0E-62
sp|P30578|CHS3_AJECA Chitin synthase 3 (Fragment) OS=Ajellomyces capsulatus GN=CHS3 PE=3 SV=1 178 364 6.0E-62
sp|P55003|CHS1_TUBUN Chitin synthase 1 (Fragment) OS=Tuber uncinatum GN=CHS1 PE=3 SV=1 178 364 1.0E-60
sp|P30604|CHS2_XYLBA Chitin synthase 2 (Fragment) OS=Xylohypha bantiana GN=CHS2 PE=3 SV=1 178 364 9.0E-60
sp|P30577|CHS2_AJECA Chitin synthase 2 (Fragment) OS=Ajellomyces capsulatus GN=CHS2 PE=3 SV=1 178 363 2.0E-45
sp|P30593|CHS2_RHIAT Chitin synthase 2 (Fragment) OS=Rhinocladiella atrovirens GN=CHS2 PE=3 SV=1 178 364 7.0E-44
sp|P30587|CHS3_EXOJE Chitin synthase 3 (Fragment) OS=Exophiala jeanselmei GN=CHS3 PE=3 SV=1 200 364 2.0E-43
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 236 586 8.0E-14
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 312 487 2.0E-12
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 312 544 3.0E-12
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 310 487 6.0E-12
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 310 487 1.0E-11
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 309 544 2.0E-11
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 309 487 3.0E-10
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 307 487 3.0E-09
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 312 487 4.0E-09
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 310 487 9.0E-09
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 310 487 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0004100 chitin synthase activity Yes
GO:0006031 chitin biosynthetic process Yes
GO:0046349 amino sugar biosynthetic process No
GO:0016757 glycosyltransferase activity No
GO:0008194 UDP-glycosyltransferase activity No
GO:0006022 aminoglycan metabolic process No
GO:0009058 biosynthetic process No
GO:1901071 glucosamine-containing compound metabolic process No
GO:1901073 glucosamine-containing compound biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008375 acetylglucosaminyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0006023 aminoglycan biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006040 amino sugar metabolic process No
GO:0008152 metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:1901135 carbohydrate derivative metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0003674 molecular_function No
GO:0006030 chitin metabolic process No
GO:0003824 catalytic activity No
GO:0016758 hexosyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

Domain # Start End Length
1 482 501 19
2 522 544 22
3 564 586 22
4 598 620 22
5 642 664 22
6 776 798 22
7 818 840 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|004850
MAHRHNDPYGQYVPPQAGYNTKYPHDYDDQSNWDAKSYQSSYAGSQAHLNPTEMTQVTTSQHHIPPVPSLPYHPM
YPPQNAGLRPQQTGWSDARDKLLKRRSVRQVQLFQGNLVLDVPVPASIIPAGMGHLEEMSKMRYTAATCDPDDFM
ASKFSLRPYLYKRHTELFIVMTMYNEDEFLFVKTMNAVIKNIAHLCGRNRSKVWGQEGWKKVVVCVVSDGRSKIN
KRTLQVLTLMGCYQEGIAKDSVGGKDVTAHIFEYTSNVVVTETGEVSQGSCPVQVLFCLKEQNKKKLNSHRWFFN
AFGPLINPNVCVLLDVGTKPTGTSIYELWKCFDKHSGVGGACGEICVDTGRGCGLLLTSPLAASQNFEYKISNIL
DKPLESVFGYISVLPGAFSAYRYKALQNGPDGKGPLASYFKGETMHGGNSSAGLFERNMYLAEDRILCFEIVTKK
REAWTLKYVKSAKASTDVPTSVPEFISQRRRWLNGSLFASIHATVFFFRIWTSGQNIFRMFLLQFEFIYNAIQLV
FTWTSLANYYLAFFFLVSSATANANSDAFNFLSHGAGKAVFEIFLNLYIGVIFLVLVCSLGNRPQGSKWAYTFAI
LMFGLCNIIATWCAIYTVYNEVRDDLHSVDQFPHVLLHNSDFQQVFIAVLATYGLYFIGSFMHFEPWHMFTSFAQ
YLFFLPSYVNILMMYAMCNLHDVTWGTKGDNGAAKDLGGAKKIKGDDGKDIMEVELPTEKEDVERLWAASRSALK
VKQPQEKEHRDAATKQADHDRNSRTNVVLAWVGTNMLLIVVFTSTVFQEWVATHITKQGSTFNPYLTFLFYAFAG
LSAVRFLGSFLYLVLRLIGC*
Coding >AgabiH97|004850
ATGGCTCACCGCCACAACGATCCTTATGGACAATACGTCCCGCCGCAGGCCGGCTACAACACAAAGTACCCTCAC
GACTATGACGACCAGTCGAACTGGGACGCAAAATCCTACCAGAGCAGTTACGCTGGCTCTCAGGCGCACCTCAAT
CCTACCGAGATGACCCAAGTCACTACATCCCAGCACCACATTCCCCCCGTCCCTTCCCTCCCGTATCACCCAATG
TACCCGCCTCAGAACGCCGGCCTCAGGCCCCAGCAAACCGGCTGGTCCGATGCAAGGGATAAACTCCTCAAGAGA
AGGTCTGTTCGCCAGGTCCAACTCTTCCAAGGCAATCTCGTTCTCGATGTCCCCGTCCCCGCTTCCATTATTCCT
GCCGGTATGGGACACCTCGAAGAAATGTCCAAAATGAGATACACCGCCGCAACCTGCGACCCCGATGATTTCATG
GCCTCCAAGTTCTCCCTTCGACCCTATCTATACAAGCGCCACACCGAGCTCTTCATCGTCATGACAATGTACAAC
GAGGACGAATTTTTATTTGTAAAAACTATGAACGCCGTCATCAAAAACATTGCCCATCTTTGTGGCAGGAACCGC
TCAAAGGTCTGGGGTCAAGAGGGCTGGAAAAAGGTGGTAGTTTGCGTCGTCTCCGATGGCCGGAGCAAGATCAAC
AAGCGCACTCTCCAAGTCCTCACTCTCATGGGCTGTTACCAGGAAGGCATAGCCAAAGATTCTGTCGGCGGCAAA
GATGTCACAGCCCACATCTTTGAATATACTTCAAACGTCGTTGTCACGGAAACAGGCGAGGTATCACAAGGCTCT
TGTCCCGTCCAGGTTCTTTTCTGCCTCAAAGAGCAAAACAAGAAAAAGCTCAACAGCCATCGCTGGTTCTTCAAC
GCCTTTGGTCCTCTCATCAACCCTAATGTTTGTGTTCTTCTCGATGTCGGTACCAAGCCAACGGGGACCTCTATC
TATGAGCTCTGGAAGTGTTTCGACAAGCATTCGGGTGTTGGTGGAGCTTGTGGAGAAATCTGTGTCGATACAGGC
CGTGGATGTGGTCTCTTACTGACGAGCCCCCTTGCTGCCTCGCAAAACTTTGAGTACAAAATTTCTAATATCCTC
GATAAACCTTTGGAGAGTGTTTTTGGCTACATCAGCGTTTTGCCCGGTGCATTTAGCGCTTACCGTTACAAAGCT
CTTCAAAATGGTCCCGATGGGAAGGGGCCTCTGGCTTCTTACTTCAAGGGTGAGACTATGCATGGTGGCAATAGC
TCAGCTGGACTCTTTGAGCGAAACATGTACCTGGCCGAGGATCGTATCTTGTGCTTTGAAATTGTGACTAAAAAA
CGCGAAGCATGGACTCTCAAATATGTCAAGAGTGCCAAGGCGTCGACTGATGTTCCGACCTCTGTCCCGGAATTC
ATCTCGCAGCGTCGCCGTTGGTTGAATGGATCCCTCTTTGCTTCAATCCACGCCACCGTATTCTTCTTCCGTATC
TGGACATCTGGTCAAAACATCTTTCGAATGTTCCTCCTACAGTTCGAGTTCATCTACAATGCAATCCAACTTGTG
TTCACATGGACTTCTCTGGCTAATTATTATCTGGCTTTCTTCTTTCTTGTTTCTTCTGCCACAGCCAATGCTAAC
TCTGACGCGTTCAATTTCCTCAGTCACGGCGCAGGGAAAGCTGTCTTTGAAATATTTCTCAACCTTTACATTGGT
GTTATTTTCCTCGTCCTCGTCTGTTCCTTGGGAAACCGTCCCCAAGGTTCAAAATGGGCATACACATTTGCGATA
CTCATGTTTGGTCTGTGCAACATCATTGCGACTTGGTGTGCCATATATACGGTTTATAATGAAGTTCGCGATGAC
CTTCACAGCGTGGACCAGTTCCCTCATGTGTTACTCCATAACTCCGACTTCCAACAAGTGTTCATTGCCGTTCTC
GCCACATATGGTCTCTATTTCATCGGCTCTTTCATGCATTTTGAACCCTGGCACATGTTTACCTCGTTTGCGCAG
TACTTGTTCTTCCTGCCATCCTACGTCAACATTCTCATGATGTATGCCATGTGTAATTTGCACGACGTCACATGG
GGTACCAAGGGCGACAATGGAGCCGCGAAAGATTTAGGCGGCGCCAAGAAGATCAAGGGTGACGATGGAAAAGAC
ATAATGGAAGTTGAATTGCCAACTGAGAAGGAGGATGTCGAACGCCTTTGGGCTGCTTCTAGAAGTGCACTCAAG
GTCAAACAGCCTCAAGAGAAGGAGCATCGTGACGCTGCTACGAAACAAGCTGATCATGACAGAAACAGTCGAACA
AATGTCGTTCTTGCTTGGGTCGGCACGAATATGTTATTGATTGTCGTCTTCACATCAACTGTATTCCAAGAATGG
GTGGCTACTCACATAACCAAGCAAGGAAGCACATTCAACCCATATCTCACTTTCCTATTCTACGCTTTTGCCGGT
CTGTCTGCAGTCCGCTTCTTGGGATCATTCTTATACCTTGTACTTCGACTCATTGGCTGCTAA
Transcript >AgabiH97|004850
ATGGCTCACCGCCACAACGATCCTTATGGACAATACGTCCCGCCGCAGGCCGGCTACAACACAAAGTACCCTCAC
GACTATGACGACCAGTCGAACTGGGACGCAAAATCCTACCAGAGCAGTTACGCTGGCTCTCAGGCGCACCTCAAT
CCTACCGAGATGACCCAAGTCACTACATCCCAGCACCACATTCCCCCCGTCCCTTCCCTCCCGTATCACCCAATG
TACCCGCCTCAGAACGCCGGCCTCAGGCCCCAGCAAACCGGCTGGTCCGATGCAAGGGATAAACTCCTCAAGAGA
AGGTCTGTTCGCCAGGTCCAACTCTTCCAAGGCAATCTCGTTCTCGATGTCCCCGTCCCCGCTTCCATTATTCCT
GCCGGTATGGGACACCTCGAAGAAATGTCCAAAATGAGATACACCGCCGCAACCTGCGACCCCGATGATTTCATG
GCCTCCAAGTTCTCCCTTCGACCCTATCTATACAAGCGCCACACCGAGCTCTTCATCGTCATGACAATGTACAAC
GAGGACGAATTTTTATTTGTAAAAACTATGAACGCCGTCATCAAAAACATTGCCCATCTTTGTGGCAGGAACCGC
TCAAAGGTCTGGGGTCAAGAGGGCTGGAAAAAGGTGGTAGTTTGCGTCGTCTCCGATGGCCGGAGCAAGATCAAC
AAGCGCACTCTCCAAGTCCTCACTCTCATGGGCTGTTACCAGGAAGGCATAGCCAAAGATTCTGTCGGCGGCAAA
GATGTCACAGCCCACATCTTTGAATATACTTCAAACGTCGTTGTCACGGAAACAGGCGAGGTATCACAAGGCTCT
TGTCCCGTCCAGGTTCTTTTCTGCCTCAAAGAGCAAAACAAGAAAAAGCTCAACAGCCATCGCTGGTTCTTCAAC
GCCTTTGGTCCTCTCATCAACCCTAATGTTTGTGTTCTTCTCGATGTCGGTACCAAGCCAACGGGGACCTCTATC
TATGAGCTCTGGAAGTGTTTCGACAAGCATTCGGGTGTTGGTGGAGCTTGTGGAGAAATCTGTGTCGATACAGGC
CGTGGATGTGGTCTCTTACTGACGAGCCCCCTTGCTGCCTCGCAAAACTTTGAGTACAAAATTTCTAATATCCTC
GATAAACCTTTGGAGAGTGTTTTTGGCTACATCAGCGTTTTGCCCGGTGCATTTAGCGCTTACCGTTACAAAGCT
CTTCAAAATGGTCCCGATGGGAAGGGGCCTCTGGCTTCTTACTTCAAGGGTGAGACTATGCATGGTGGCAATAGC
TCAGCTGGACTCTTTGAGCGAAACATGTACCTGGCCGAGGATCGTATCTTGTGCTTTGAAATTGTGACTAAAAAA
CGCGAAGCATGGACTCTCAAATATGTCAAGAGTGCCAAGGCGTCGACTGATGTTCCGACCTCTGTCCCGGAATTC
ATCTCGCAGCGTCGCCGTTGGTTGAATGGATCCCTCTTTGCTTCAATCCACGCCACCGTATTCTTCTTCCGTATC
TGGACATCTGGTCAAAACATCTTTCGAATGTTCCTCCTACAGTTCGAGTTCATCTACAATGCAATCCAACTTGTG
TTCACATGGACTTCTCTGGCTAATTATTATCTGGCTTTCTTCTTTCTTGTTTCTTCTGCCACAGCCAATGCTAAC
TCTGACGCGTTCAATTTCCTCAGTCACGGCGCAGGGAAAGCTGTCTTTGAAATATTTCTCAACCTTTACATTGGT
GTTATTTTCCTCGTCCTCGTCTGTTCCTTGGGAAACCGTCCCCAAGGTTCAAAATGGGCATACACATTTGCGATA
CTCATGTTTGGTCTGTGCAACATCATTGCGACTTGGTGTGCCATATATACGGTTTATAATGAAGTTCGCGATGAC
CTTCACAGCGTGGACCAGTTCCCTCATGTGTTACTCCATAACTCCGACTTCCAACAAGTGTTCATTGCCGTTCTC
GCCACATATGGTCTCTATTTCATCGGCTCTTTCATGCATTTTGAACCCTGGCACATGTTTACCTCGTTTGCGCAG
TACTTGTTCTTCCTGCCATCCTACGTCAACATTCTCATGATGTATGCCATGTGTAATTTGCACGACGTCACATGG
GGTACCAAGGGCGACAATGGAGCCGCGAAAGATTTAGGCGGCGCCAAGAAGATCAAGGGTGACGATGGAAAAGAC
ATAATGGAAGTTGAATTGCCAACTGAGAAGGAGGATGTCGAACGCCTTTGGGCTGCTTCTAGAAGTGCACTCAAG
GTCAAACAGCCTCAAGAGAAGGAGCATCGTGACGCTGCTACGAAACAAGCTGATCATGACAGAAACAGTCGAACA
AATGTCGTTCTTGCTTGGGTCGGCACGAATATGTTATTGATTGTCGTCTTCACATCAACTGTATTCCAAGAATGG
GTGGCTACTCACATAACCAAGCAAGGAAGCACATTCAACCCATATCTCACTTTCCTATTCTACGCTTTTGCCGGT
CTGTCTGCAGTCCGCTTCTTGGGATCATTCTTATACCTTGTACTTCGACTCATTGGCTGCTAA
Gene >AgabiH97|004850
ATGGCTCACCGCCACAACGATCCTTATGGACGTAAGTCGACTGCCCCCGCTCTTACTTCCCCCGCTTCATGTCTC
TCTGCAGAATACGTCCCGCCGCAGGCCGGCTACAACACAAAGTACCCTCACGACTATGACGACCAGTCGAACTGG
GACGCAAAATCCTACCAGAGCAGTTACGCTGGCTCTCAGGCGCACCTCAATCCTACCGAGATGACCCAAGTCACT
ACATCCCAGCACCACATTCCCCCCGTCCCTTCCCTCCCGTATCACCCAATGTACCCGCCTCAGAACGCCGGCCTC
AGGCCCCAGCAAACCGGCTGGTCCGATGCAAGGGATAAACTCCTCAAGAGAAGGTCTGTTCGCCAGGTCCAACTC
TTCCAAGGCAATCTCGTTCTCGATGTCCCCGTCCCCGCTTCCATTATTCCTGCCGGTATGGGACACCTCGAAGAA
ATGTCCAAAATGAGATACACCGCCGCAACCTGCGACCCCGATGATTTCATGGCCTCCAAGTTCTCCCTTCGACCC
TATCTATACAAGCGCCACACCGAGCTCTTCATCGTCATGACAATGTACAACGAGGACGAATTTTTATTTGTAAAA
ACTATGAACGCGTGCGTCCCATCATTAATATTTTTCTCTCTATTCATTCGCTTATCTTCTACCCCCAAAGCGTCA
TCAAAAACATTGCCCATCTTTGTGGCAGGAACCGCTCAAAGGTCTGGGGTCAAGAGGGCTGGAAAAAGGTGGTAG
TTTGCGTCGTCTCCGATGGCCGGAGCAAGATCAACAAGCGCACTCTCCAAGTCCTCACTCTCGTGAGTTGGCCAG
CATTCATACCAACATCTAGAACTAGTTATCCATCATTTTCATCAGATGGGCTGTTACCAGGAAGGCATAGCCAAA
GATTCTGTCGGCGGCAAAGATGTCACAGCCCACATCTTTGAGTAGGTGTTATCATCCGTCCAACTCTTACGCCAT
CATCTGACATGATCAGATATACTTCAAACGTCGTTGTCACGGAAACAGGCGAGGTATCACAAGGCTCTTGTCCCG
TCCAGGTTCTTTTCTGCCTCAAAGAGCAAAACAAGAAAAAGCTCAACAGCCATCGCTGGTTCTTCAACGCCTTTG
GTCCTCTCATCAACCCTAATGGTATGTTCTTTCTCCTTGTTGATAGCCATTGTTTAAGCTGTATCTTGTCAGTTT
GTGTTCTTCTCGATGTCGGTACCAAGCCAACGGGGACCTCTATCTATGAGCTCTGGAAGTGTAAGCCAATCTCAC
GTCCTAAATTATTTCTCTACTTATATGCAAAAGGTTTCGACAAGCATTCGGGTGTTGGTGGAGCTTGTGGAGAGT
AAGCCTTTCGTTTTTCTCATTTTGCTTGTTGTCTAAGTAACGTCTAGAATCTGTGTCGATACAGGCCGTGGATGT
GGTCTCTTACTGACGAGCCCCCTTGCTGCCTCGCAAAACTTTGAGGTATTTCTTTTGTATATCACGCGGGTTTAT
TCTGATCATCTCGATTTTTGTTCCAGTACAAAATTTCTAATATCCTCGATAAACCTTTGGAGGTACATTGTCAAT
CATCATCCCTCAAGTCTCACACTAAACATGTATTTTAGAGTGTTTTTGGCTACATCAGCGTTTTGCCCGGTGCAT
TTAGCGCTTACCGTTACAAAGCTCTTCAAAATGGTCCCGATGGGAAGGGGCCTCTGGCTTCTTACTTCAAGGGTG
AGACTATGCATGGTGGCAATAGCTCAGCTGGACTCTTTGAGGTGACTTGAATTTACTTGCCGCTCTAAATATGAT
TCTTACTCGATGCAGCGAAACATGTACCTGGCCGAGGATCGTATCTTGTGCTTTGAAATTGTGACTAAAAAACGC
GAAGCATGGACGTGAGTATCATACTCCATCTCGCCTCATACCGTTTTTAACTTGTGTCCATCGTGCAGTCTCAAA
TATGTCAAGAGTGCCAAGGCGTCGACTGATGTTCCGACCTCTGTGGGTTATCTTCCTCGTCATCTTATTGTCGCT
GACTGTGTCGCAGGTCCCGGAATTCATCTCGCAGCGTCGCCGTTGGTTGAATGGATCCCTCTTTGCTTCAATCCA
CGCCACCGTATTCTTCTTCCGTATCTGGACATCTGGTCAAAACATCTTTCGAATGTTCCTCCTACAGGTAATTTG
CAACACTAATCTTTCATTTTTCAATCTCAAACCCTATTTTTCAGTTCGAGTTCATCTACAATGCAATCCAACTTG
TGTTCACATGGACTTCTCTGGCTAATTATTATCTGGCTTTCTTCTTTGTAAGTAACAATTGTTCTACCCGCCGCA
GCTAAATTGTTAATGTCGCCTAGCTTGTTTCTTCTGCCACAGCCAATGCTAACTCTGACGCGTTCAATTTCCTCA
GTCACGGCGCAGGGAAAGCTGTCTTTGAAATATTTCTCAACCTTTACATTGGTGTTATTTTCCTCGTCCTCGTCT
GTTCCTTGGGAAACCGTCCCCAAGGTTCAAAATGGGCATACACATTTGCGATACTCATGTTTGGTCTGTGCAACA
TCATTGCGACTTGGTGTGCCATATATACGGTTTATAATGAAGTTCGCGATGACCTTCACAGCGTGGACCAGTTCC
CTCAGTATGTTTCATTATTATTTCATACTCTCAACTGTCTAACCGCATTCTTCTTAGTGTGTTACTCCATAACTC
CGACTTCCAACAAGTGTTCATTGCCGTTCTCGCCACATATGGTCTCTATTTCATCGGCTCTTTCATGCATTTTGA
ACCCTGGCACATGTTTACCTCGTTTGCGCAGTACTTGTTCTTCCTGCCATCCTACGTCAACATTCTCATGATGTA
TGCCATGTGTAATTTGCACGACGTCACATGGGGTACCAAGGGCGACAATGGAGCCGCGAAAGATTTAGGCGGCGC
CAAGAAGATCAAGGGTGACGATGGAAAAGACATAATGGAAGTTGAATTGCCAACTGAGAAGGAGGATGTCGAACG
CCTTTGGGCTGCTTCTAGAAGTGCACTCAAGGTCAAACAGCCTCAAGAGAAGGAGCATCGTGACGCTGCTACGAA
ACAAGCTGATCATGACAGAAACAGTCGAACAAATGTCGTTCTTGCTTGGGTCGGCACGAATATGTGAGTCGTGCT
TTCTTTTTTTTTTGGGGTCATTACGTCTATGCGGTGCCTTGTATTATTTCACCCCAAATCGTGGTGTGTTGTCGG
AGTTTTTTCCATTTTTTTCCCGACTGTTTCAGCGTCTGATGAAACTACAATGTGCTGATTGATGTTTTTTTTTTT
TTTGATTGAAAGGTTATTGATTGTCGTCTTCACATCAACTGTATTCCAAGAATGGGTGGCTACTCACATAACCAA
GCAAGGAAGCACATTCAACCCATATCTCACTTTCCTATTCTACGCTTTGTGAGTAATAAAACCGTGCTGTTTAGT
ATAGAGATGACTGACCAACTTGTCTTTGTGGTTTTTTCAGTGCCGGTCTGTCTGCAGTCCGCTTCTTGGGATCAT
TCTTATACCTTGTACTTCGACTCATTGGCTGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail