Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|004710
Gene name
Locationscaffold_1:1159624..1161832
Strand-
Gene length (bp)2208
Transcript length (bp)2049
Coding sequence length (bp)2049
Protein length (aa) 683

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 8.2E-15 206 299
PF08241 Methyltransf_11 Methyltransferase domain 3.2E-10 207 301
PF13489 Methyltransf_23 Methyltransferase domain 6.6E-08 197 303
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 8.6E-07 195 305

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 201 305 4.0E-08
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 201 305 4.0E-08
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 201 305 4.0E-08
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 201 305 4.0E-08
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 201 305 4.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 201 305 4.0E-08
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 201 305 4.0E-08
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 201 305 4.0E-08
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 201 305 4.0E-08
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 201 305 4.0E-08
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 201 305 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|004710
MTTTSSRRAPHKSLFPFLARSGHESSTVPRPKGRPTGHYRPVSQLLLEEADDKSQSAKSSRRDSVSLFMAISDRS
LLDVVHKSLRDKEKKDKERGPGVVPSCVAKEREWSVPPRSGLIQEVSIEPFEHVANIVPKRFYDDGNICCSEDVL
VKEKVRQDLYSGDSVYMQSYDRIMVENEMYTNSLLRRLASSAPTFSTSMDKQPSNVLDLGCGQGYWLLDASYHWP
YAKFAGFDLVDVMLPEVRERPNIRLVQGNFVSNSLPFPDQSFDFVRLADLGLAIPHEKWSFVISEARRVLTVGGQ
IEVIDDQLFFPYGPLPEVSPPTPPPLVGSKSLRHNASRCRVKSNSGTPIFDGHEANSTYIKPVKNGNGFDSLLQT
AKVSQRRSEDYRKQWLSACQISHDVEDTFVGMLLKNFVHPSPHAFISDLLGFTFGSQNVCNTQTFDIQLAPLSSA
PPHRIDTLTSLRFDDCSDQGSSGSTEGKDCRHSPASREHSPTQSSPSSLYSAKAADRLGISYSDLVAVTTSMKQL
VPDNRNSYADSVVDEICQSPGIIVSPSTFIPLTSVETEFHACKWMHTLLGWRTALADHIHSCTDDDGKIIVADSE
WNDALWTYESFRRQRFHWPMNAEYDPDSFASPSIISMHNRDLQSFLENYEKPVQIRTIRVYHATKTGMTSFASLP
SSSFSSH*
Coding >AgabiH97|004710
ATGACTACCACGAGTTCCCGCCGGGCTCCACATAAGTCCCTTTTTCCATTCCTTGCTCGTTCAGGACACGAAAGC
TCGACTGTACCCCGGCCAAAAGGGCGTCCGACCGGCCACTATCGCCCCGTGTCACAATTGCTGTTGGAAGAAGCT
GACGATAAGTCACAATCCGCCAAATCATCTCGAAGAGATTCAGTGTCGTTATTTATGGCTATTTCGGACCGTTCG
TTGTTAGATGTGGTTCATAAGTCGTTGAGAGACAAGGAAAAGAAGGACAAGGAAAGAGGCCCAGGCGTGGTACCT
TCTTGCGTGGCTAAAGAAAGAGAATGGTCTGTGCCCCCTCGGAGCGGACTCATACAGGAGGTGTCGATTGAGCCT
TTCGAGCATGTAGCAAATATTGTCCCAAAACGATTTTACGATGATGGTAATATCTGCTGCTCTGAAGATGTCTTG
GTGAAGGAGAAGGTGCGGCAGGATCTTTATTCAGGCGACAGTGTTTATATGCAATCTTATGACCGGATTATGGTT
GAAAATGAAATGTACACAAATTCATTGCTGCGTCGTCTAGCTTCGTCAGCCCCGACTTTCAGTACTTCGATGGAC
AAACAACCAAGCAACGTGCTAGACCTGGGCTGCGGACAAGGTTATTGGTTATTGGATGCTTCATACCACTGGCCC
TACGCAAAATTCGCTGGCTTTGATTTGGTCGATGTTATGCTACCAGAAGTGCGGGAACGACCAAATATTCGCTTG
GTTCAAGGAAACTTTGTCAGTAACTCCTTACCATTTCCAGACCAAAGTTTCGATTTCGTTCGTCTAGCAGATTTG
GGTCTCGCCATTCCGCACGAAAAATGGAGCTTCGTGATTTCCGAAGCCCGGCGCGTCTTGACTGTCGGAGGCCAG
ATAGAAGTGATTGATGACCAACTTTTTTTCCCTTACGGCCCCTTGCCCGAAGTATCTCCCCCTACCCCTCCTCCA
CTGGTTGGCTCGAAGTCACTCCGGCACAACGCTTCCCGTTGTCGAGTAAAGTCCAATTCTGGTACTCCAATATTC
GACGGACACGAAGCAAACAGTACCTATATCAAACCTGTGAAGAATGGAAATGGATTCGACTCCTTGTTGCAAACA
GCAAAAGTTTCTCAGCGGCGCTCGGAAGATTACCGTAAACAGTGGCTCTCCGCTTGCCAAATTTCTCATGATGTG
GAGGATACCTTTGTTGGTATGCTGCTGAAAAATTTCGTTCATCCCTCTCCCCACGCTTTCATTTCTGATCTGCTG
GGGTTTACTTTCGGCTCTCAAAACGTCTGCAACACGCAAACGTTTGACATTCAGCTTGCTCCTTTGTCTTCGGCT
CCGCCGCATCGGATCGATACACTCACAAGTTTGAGGTTCGATGACTGCTCCGATCAAGGTTCAAGCGGTTCTACC
GAGGGAAAAGATTGTCGGCATTCACCTGCAAGCCGTGAACACAGCCCCACTCAGTCCTCTCCTTCGTCGCTGTAC
AGCGCAAAAGCTGCAGACCGCCTAGGTATATCTTACTCGGACCTTGTTGCGGTGACCACATCAATGAAACAACTA
GTGCCTGACAACCGTAATTCATACGCTGATTCAGTCGTTGATGAAATCTGTCAATCCCCTGGGATCATCGTCTCC
CCCTCAACATTCATTCCCCTCACTTCTGTCGAGACCGAATTTCATGCTTGCAAATGGATGCATACACTCCTGGGG
TGGCGAACCGCTCTCGCTGATCACATTCATTCATGCACCGACGATGATGGAAAGATAATAGTGGCCGACTCTGAG
TGGAATGATGCACTCTGGACATACGAGAGCTTCCGACGTCAAAGGTTCCATTGGCCTATGAACGCGGAGTATGAC
CCTGACAGCTTTGCATCACCATCTATCATCAGTATGCACAATCGAGACCTCCAATCCTTCCTTGAAAATTATGAA
AAACCTGTCCAAATTCGAACCATTCGTGTATATCATGCAACAAAAACTGGGATGACTTCTTTTGCCAGCCTTCCT
TCTAGCTCATTCTCCAGTCACTGA
Transcript >AgabiH97|004710
ATGACTACCACGAGTTCCCGCCGGGCTCCACATAAGTCCCTTTTTCCATTCCTTGCTCGTTCAGGACACGAAAGC
TCGACTGTACCCCGGCCAAAAGGGCGTCCGACCGGCCACTATCGCCCCGTGTCACAATTGCTGTTGGAAGAAGCT
GACGATAAGTCACAATCCGCCAAATCATCTCGAAGAGATTCAGTGTCGTTATTTATGGCTATTTCGGACCGTTCG
TTGTTAGATGTGGTTCATAAGTCGTTGAGAGACAAGGAAAAGAAGGACAAGGAAAGAGGCCCAGGCGTGGTACCT
TCTTGCGTGGCTAAAGAAAGAGAATGGTCTGTGCCCCCTCGGAGCGGACTCATACAGGAGGTGTCGATTGAGCCT
TTCGAGCATGTAGCAAATATTGTCCCAAAACGATTTTACGATGATGGTAATATCTGCTGCTCTGAAGATGTCTTG
GTGAAGGAGAAGGTGCGGCAGGATCTTTATTCAGGCGACAGTGTTTATATGCAATCTTATGACCGGATTATGGTT
GAAAATGAAATGTACACAAATTCATTGCTGCGTCGTCTAGCTTCGTCAGCCCCGACTTTCAGTACTTCGATGGAC
AAACAACCAAGCAACGTGCTAGACCTGGGCTGCGGACAAGGTTATTGGTTATTGGATGCTTCATACCACTGGCCC
TACGCAAAATTCGCTGGCTTTGATTTGGTCGATGTTATGCTACCAGAAGTGCGGGAACGACCAAATATTCGCTTG
GTTCAAGGAAACTTTGTCAGTAACTCCTTACCATTTCCAGACCAAAGTTTCGATTTCGTTCGTCTAGCAGATTTG
GGTCTCGCCATTCCGCACGAAAAATGGAGCTTCGTGATTTCCGAAGCCCGGCGCGTCTTGACTGTCGGAGGCCAG
ATAGAAGTGATTGATGACCAACTTTTTTTCCCTTACGGCCCCTTGCCCGAAGTATCTCCCCCTACCCCTCCTCCA
CTGGTTGGCTCGAAGTCACTCCGGCACAACGCTTCCCGTTGTCGAGTAAAGTCCAATTCTGGTACTCCAATATTC
GACGGACACGAAGCAAACAGTACCTATATCAAACCTGTGAAGAATGGAAATGGATTCGACTCCTTGTTGCAAACA
GCAAAAGTTTCTCAGCGGCGCTCGGAAGATTACCGTAAACAGTGGCTCTCCGCTTGCCAAATTTCTCATGATGTG
GAGGATACCTTTGTTGGTATGCTGCTGAAAAATTTCGTTCATCCCTCTCCCCACGCTTTCATTTCTGATCTGCTG
GGGTTTACTTTCGGCTCTCAAAACGTCTGCAACACGCAAACGTTTGACATTCAGCTTGCTCCTTTGTCTTCGGCT
CCGCCGCATCGGATCGATACACTCACAAGTTTGAGGTTCGATGACTGCTCCGATCAAGGTTCAAGCGGTTCTACC
GAGGGAAAAGATTGTCGGCATTCACCTGCAAGCCGTGAACACAGCCCCACTCAGTCCTCTCCTTCGTCGCTGTAC
AGCGCAAAAGCTGCAGACCGCCTAGGTATATCTTACTCGGACCTTGTTGCGGTGACCACATCAATGAAACAACTA
GTGCCTGACAACCGTAATTCATACGCTGATTCAGTCGTTGATGAAATCTGTCAATCCCCTGGGATCATCGTCTCC
CCCTCAACATTCATTCCCCTCACTTCTGTCGAGACCGAATTTCATGCTTGCAAATGGATGCATACACTCCTGGGG
TGGCGAACCGCTCTCGCTGATCACATTCATTCATGCACCGACGATGATGGAAAGATAATAGTGGCCGACTCTGAG
TGGAATGATGCACTCTGGACATACGAGAGCTTCCGACGTCAAAGGTTCCATTGGCCTATGAACGCGGAGTATGAC
CCTGACAGCTTTGCATCACCATCTATCATCAGTATGCACAATCGAGACCTCCAATCCTTCCTTGAAAATTATGAA
AAACCTGTCCAAATTCGAACCATTCGTGTATATCATGCAACAAAAACTGGGATGACTTCTTTTGCCAGCCTTCCT
TCTAGCTCATTCTCCAGTCACTGA
Gene >AgabiH97|004710
ATGACTACCACGAGTTCCCGCCGGGCTCCACATAAGTCCCTTTTTCCATTCCTTGCTCGTTCAGGACACGAAAGC
TCGACTGTACCCCGGCCAAAAGGGCGTCCGACCGGCCACTATCGCCCCGTGTCACAATTGCTGTTGGAAGAAGCT
GACGATAAGTCACAATCCGCCAAATCATCTCGAAGAGATTCAGTGTCGTTATTTATGGCTATTTCGGACCGTTCG
TTGTTAGATGTGGTTCATAAGTCGTTGAGAGACAAGGAAAAGAAGGACAAGGAAAGAGGCCCAGGCGTGGTACCT
TCTTGCGTGGCTAAAGAAAGAGAATGGTCTGTGCCCCCTCGGAGCGGACTCATACAGGAGGTGTCGATTGAGCCT
TTCGAGCATGTAGCAAATATTGTCCCAAAACGATTTTACGATGATGGTAATATCTGCTGCTCTGAAGATGTCTTG
GTGAAGGAGAAGGTGCGGCAGGATCTTTATTCAGGCGACAGTGTTTATATGCAATCTTATGACCGGATTATGGTT
GAAAAGTGAGGGTCAATACTTTGGACTAATTGGTTTTAATGATGAAGATTCTCTCAGTGAAATGTACACAAATTC
ATTGCTGCGTCGTCTAGCTTCGTCAGCCCCGACTTTCAGTACTTCGATGGACAAACAACCAAGCAACGTGCTAGA
CCTGGGCTGCGGACAAGGTTATTGGTTATTGGATGCTTCATACCACTGGCCCTACGCAAAATTCGCTGGCTTTGA
TTTGGTCGATGTTATGCTACCAGAAGTGCGGGAACGACCAAATATTCGCTTGGTTCAAGGAAACTTGTATGTATT
GTCCCTTTCCAACAGAGGTCCCAACTTATCAACCAGTTCCAGTGTCAGTAACTCCTTACCATTTCCAGACCAAAG
TTTCGATTTCGTTCGTCTAGCAGATTTGGGTCTCGCCATTCCGCACGAAAAATGGAGCTTCGTGATTTCCGAAGC
CCGGCGCGTCTTGACTGTCGGAGGCCAGATAGAAGTGATTGATGACCAACTTTTTTTCCCTTACGGCCCCTTGCC
CGAAGTATCTCCCCCTACCCCTCCTCCACTGGTTGGCTCGAAGTCACTCCGGCACAACGCTTCCCGTTGTCGAGT
AAAGTCCAATTCTGGTACTCCAATATTCGACGGACACGAAGCAAACAGTACCTATATCAAACCTGTGAAGAATGG
AAATGGATTCGACTCCTTGTTGCAAACAGCAAAAGTTTCTCAGCGGCGCTCGGAAGATTACCGTAAACAGTGGCT
CTCCGCTTGCCAAATTTCTCATGATGTGGAGGATACCTTTGTTGGTATGCTGCTGAAAAATTTCGTTCATCCCTC
TCCCCACGCTTTCATTTCTGATCTGCTGGGGTTTACTTTCGGCTCTCAAAACGTCTGCAACACGCAAACGTTTGA
CATTCAGCTTGCTCCTTTGTCTTCGGCTCCGCCGCATCGGATCGATACACTCACAAGTTTGAGGTTCGATGACTG
CTCCGATCAAGGTTCAAGCGGTTCTACCGAGGGAAAAGATTGTCGGCATTCACCTGCAAGCCGTGAACACAGCCC
CACTCAGTCCTCTCCTTCGTCGCTGTACAGCGCAAAAGCTGCAGACCGCCTAGGTATATCTTACTCGGACCTTGT
TGCGGTGACCACATCAATGAAACAACTAGTGCCTGACAACCGTAATTCATACGCTGATTCAGTCGTTGATGAAAT
CTGTCAATCCCCTGGGATCATCGTCTCCCCCTCAACATTCATTCCCCTCACTTCTGTCGAGACCGAATTTCATGC
TTGCAAATGGATGCATACACTCCTGGGGTGGCGAACCGCTCTCGCTGATCACATTCATTCATGCACCGACGATGA
TGGAAAGATAATAGTGGCCGACTCTGAGTGGAATGATGCACTCTGGACATACGAGAGGTGCAGTCTCTGATAATA
CTGCTCGTACTGTGACTGAAACGTGTTGATTTACGTAGCTTCCGACGTCAAAGGTTCCATTGGCCTATGAACGCG
GAGTATGACCCTGACAGCTTTGCATCACCATCTATCATCAGTATGCACAATCGAGACCTCCAATCCTTCCTTGAA
AATTATGAAAAACCTGTCCAAATTCGAACCATTCGTGTATATCATGCAACAAAAACTGGGATGACTTCTTTTGCC
AGCCTTCCTTCTAGCTCATTCTCCAGTCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail