Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|004290
Gene name
Locationscaffold_1:1056056..1057718
Strand-
Gene length (bp)1662
Transcript length (bp)1260
Coding sequence length (bp)1260
Protein length (aa) 420

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 1.6E-10 236 284
PF12678 zf-rbx1 RING-H2 zinc finger domain 8.6E-10 236 284
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 2.2E-08 237 283
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 3.5E-07 237 283
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 3.4E-05 237 287

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D0C1|RN115_MOUSE E3 ubiquitin-protein ligase RNF115 OS=Mus musculus GN=Rnf115 PE=1 SV=1 8 315 1.0E-20
sp|Q91YL2|RN126_MOUSE E3 ubiquitin-protein ligase RNF126 OS=Mus musculus GN=Rnf126 PE=1 SV=1 8 299 1.0E-20
sp|Q6DIP3|RN126_XENTR E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 8 299 3.0E-19
sp|Q9BV68|RN126_HUMAN E3 ubiquitin-protein ligase RNF126 OS=Homo sapiens GN=RNF126 PE=1 SV=1 8 299 6.0E-19
sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=1 SV=1 7 287 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9D0C1|RN115_MOUSE E3 ubiquitin-protein ligase RNF115 OS=Mus musculus GN=Rnf115 PE=1 SV=1 8 315 1.0E-20
sp|Q91YL2|RN126_MOUSE E3 ubiquitin-protein ligase RNF126 OS=Mus musculus GN=Rnf126 PE=1 SV=1 8 299 1.0E-20
sp|Q6DIP3|RN126_XENTR E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 8 299 3.0E-19
sp|Q9BV68|RN126_HUMAN E3 ubiquitin-protein ligase RNF126 OS=Homo sapiens GN=RNF126 PE=1 SV=1 8 299 6.0E-19
sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=1 SV=1 7 287 1.0E-18
sp|Q9Y4L5|RN115_HUMAN E3 ubiquitin-protein ligase RNF115 OS=Homo sapiens GN=RNF115 PE=1 SV=2 8 308 5.0E-18
sp|Q9C1X4|YKW3_SCHPO Uncharacterized RING finger protein P32A8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP32A8.03c PE=3 SV=1 181 350 7.0E-18
sp|Q7T0Q3|R126A_XENLA E3 ubiquitin-protein ligase RNF126-A OS=Xenopus laevis GN=rnf126-a PE=2 SV=1 4 299 8.0E-18
sp|Q6IRP0|R126B_XENLA E3 ubiquitin-protein ligase RNF126-B OS=Xenopus laevis GN=rnf126-b PE=2 SV=1 8 299 6.0E-17
sp|Q0II22|RN126_BOVIN E3 ubiquitin-protein ligase RNF126 OS=Bos taurus GN=RNF126 PE=2 SV=1 186 326 1.0E-16
sp|P0CH30|RING1_GOSHI E3 ubiquitin-protein ligase RING1 OS=Gossypium hirsutum GN=RING1 PE=1 SV=1 183 287 1.0E-13
sp|Q8RXD3|AIP2_ARATH E3 ubiquitin-protein ligase AIP2 OS=Arabidopsis thaliana GN=AIP2 PE=1 SV=1 192 287 1.0E-12
sp|Q9CY62|RN181_MOUSE E3 ubiquitin-protein ligase RNF181 OS=Mus musculus GN=Rnf181 PE=1 SV=1 210 287 3.0E-10
sp|Q9VE61|RN181_DROME E3 ubiquitin-protein ligase RNF181 homolog OS=Drosophila melanogaster GN=CG7694 PE=2 SV=1 198 287 4.0E-10
sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 210 287 6.0E-10
sp|Q5M974|RN181_XENTR E3 ubiquitin-protein ligase RNF181 OS=Xenopus tropicalis GN=rnf181 PE=2 SV=1 210 287 1.0E-09
sp|Q7ZW78|RN181_DANRE E3 ubiquitin-protein ligase RNF181 OS=Danio rerio GN=rnf181 PE=2 SV=2 189 287 1.0E-09
sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 237 285 6.0E-09
sp|Q8NG27|PJA1_HUMAN E3 ubiquitin-protein ligase Praja-1 OS=Homo sapiens GN=PJA1 PE=1 SV=2 212 284 6.0E-09
sp|O55176|PJA1_MOUSE E3 ubiquitin-protein ligase Praja-1 OS=Mus musculus GN=Pja1 PE=1 SV=3 212 284 6.0E-09
sp|Q5R4R1|PJA2_PONAB E3 ubiquitin-protein ligase Praja-2 OS=Pongo abelii GN=PJA2 PE=2 SV=1 212 300 9.0E-09
sp|O43164|PJA2_HUMAN E3 ubiquitin-protein ligase Praja-2 OS=Homo sapiens GN=PJA2 PE=1 SV=4 212 300 9.0E-09
sp|Q63364|PJA2_RAT E3 ubiquitin-protein ligase Praja-2 OS=Rattus norvegicus GN=Pja2 PE=2 SV=1 212 284 1.0E-08
sp|Q80U04|PJA2_MOUSE E3 ubiquitin-protein ligase Praja-2 OS=Mus musculus GN=Pja2 PE=1 SV=2 212 284 1.0E-08
sp|Q9SN28|ATL7_ARATH RING-H2 finger protein ATL7 OS=Arabidopsis thaliana GN=ATL7 PE=2 SV=1 214 322 2.0E-08
sp|Q6NRX0|RN149_XENLA E3 ubiquitin-protein ligase RNF149 OS=Xenopus laevis GN=rnf149 PE=2 SV=1 235 339 2.0E-08
sp|Q9C7I1|ATL34_ARATH RING-H2 finger protein ATL34 OS=Arabidopsis thaliana GN=ATL34 PE=2 SV=1 236 292 3.0E-08
sp|Q8NC42|RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens GN=RNF149 PE=2 SV=2 235 298 3.0E-08
sp|Q3U2C5|RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus GN=Rnf149 PE=1 SV=3 214 302 3.0E-08
sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=1 SV=1 190 294 3.0E-08
sp|Q6AXU4|RN181_RAT E3 ubiquitin-protein ligase RNF181 OS=Rattus norvegicus GN=Rnf181 PE=1 SV=1 210 287 4.0E-08
sp|Q9P0P0|RN181_HUMAN E3 ubiquitin-protein ligase RNF181 OS=Homo sapiens GN=RNF181 PE=1 SV=1 210 287 5.0E-08
sp|Q9SPL2|CIP8_ARATH E3 ubiquitin-protein ligase CIP8 OS=Arabidopsis thaliana GN=CIP8 PE=1 SV=1 9 287 6.0E-08
sp|Q570X5|ATL58_ARATH RING-H2 finger protein ATL58 OS=Arabidopsis thaliana GN=ATL58 PE=2 SV=1 214 327 6.0E-08
sp|Q4KLR8|ZNRF3_XENLA E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus laevis GN=znrf3 PE=2 SV=1 190 290 9.0E-08
sp|Q84W40|ATL11_ARATH RING-H2 finger protein ATL11 OS=Arabidopsis thaliana GN=ATL11 PE=2 SV=2 236 419 1.0E-07
sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 201 288 1.0E-07
sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 201 288 1.0E-07
sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 154 284 2.0E-07
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 237 319 2.0E-07
sp|Q07G42|RNF12_XENTR E3 ubiquitin-protein ligase RNF12 OS=Xenopus tropicalis GN=rnf12 PE=2 SV=1 201 288 2.0E-07
sp|Q641J8|RF12A_XENLA E3 ubiquitin-protein ligase RNF12-A OS=Xenopus laevis GN=rnf12-a PE=1 SV=1 201 288 3.0E-07
sp|Q8GXF8|SHGR9_ARATH E3 ubiquitin-protein ligase SGR9, amyloplastic OS=Arabidopsis thaliana GN=SGR9 PE=1 SV=1 236 287 3.0E-07
sp|Q3UHJ8|RNF44_MOUSE RING finger protein 44 OS=Mus musculus GN=Rnf44 PE=2 SV=1 154 284 4.0E-07
sp|Q5SPX3|RN215_MOUSE RING finger protein 215 OS=Mus musculus GN=Rnf215 PE=2 SV=1 234 288 5.0E-07
sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 237 292 5.0E-07
sp|Q9SK92|ATL15_ARATH E3 ubiquitin-protein ligase ATL15 OS=Arabidopsis thaliana GN=ATL15 PE=1 SV=1 236 368 5.0E-07
sp|Q9ULT6|ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens GN=ZNRF3 PE=1 SV=3 237 296 5.0E-07
sp|P30631|YOUD_CAEEL Uncharacterized RING finger protein ZK637.14 OS=Caenorhabditis elegans GN=ZK637.14 PE=3 SV=2 237 284 6.0E-07
sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 237 292 6.0E-07
sp|Q7T037|RF12B_XENLA E3 ubiquitin-protein ligase RNF12-B OS=Xenopus laevis GN=rnf12-b PE=2 SV=1 201 288 7.0E-07
sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 237 313 7.0E-07
sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 237 313 7.0E-07
sp|Q8GUU2|RIE1_ARATH E3 ubiquitin protein ligase RIE1 OS=Arabidopsis thaliana GN=RIE1 PE=2 SV=1 236 289 7.0E-07
sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 237 292 7.0E-07
sp|Q86XS8|GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens GN=RNF130 PE=1 SV=1 237 292 8.0E-07
sp|Q3T0W3|RN181_BOVIN E3 ubiquitin-protein ligase RNF181 OS=Bos taurus GN=RNF181 PE=2 SV=1 210 287 1.0E-06
sp|Q9M0R4|ATL37_ARATH Putative RING-H2 finger protein ATL37 OS=Arabidopsis thaliana GN=ATL37 PE=3 SV=1 236 322 1.0E-06
sp|Q9SN27|ATL59_ARATH E3 ubiquitin-protein ligase ATL59 OS=Arabidopsis thaliana GN=ATL59 PE=1 SV=1 205 322 1.0E-06
sp|Q9M0R5|ATL36_ARATH Putative RING-H2 finger protein ATL36 OS=Arabidopsis thaliana GN=ATL36 PE=3 SV=1 236 337 1.0E-06
sp|Q9LY41|ATL4_ARATH E3 ubiquitin-protein ligase ATL4 OS=Arabidopsis thaliana GN=ATL4 PE=1 SV=1 208 284 1.0E-06
sp|Q67YI6|ATL65_ARATH RING-H2 finger protein ATL65 OS=Arabidopsis thaliana GN=ATL65 PE=2 SV=2 235 295 1.0E-06
sp|Q4V7B8|RNF44_RAT RING finger protein 44 OS=Rattus norvegicus GN=Rnf44 PE=2 SV=1 154 284 1.0E-06
sp|Q84TF5|RHA4A_ARATH RING-H2 zinc finger protein RHA4a OS=Arabidopsis thaliana GN=RHA4A PE=2 SV=1 224 301 1.0E-06
sp|Q8L649|BB_ARATH E3 ubiquitin ligase BIG BROTHER OS=Arabidopsis thaliana GN=BB PE=1 SV=1 214 291 1.0E-06
sp|Q8LGA5|ATL31_ARATH E3 ubiquitin-protein ligase ATL31 OS=Arabidopsis thaliana GN=ATL31 PE=1 SV=2 236 325 1.0E-06
sp|Q5EAE9|ATL43_ARATH RING-H2 finger protein ATL43 OS=Arabidopsis thaliana GN=ATL43 PE=2 SV=2 236 290 2.0E-06
sp|Q8RXX9|ATL6_ARATH E3 ubiquitin-protein ligase ATL6 OS=Arabidopsis thaliana GN=ATL6 PE=1 SV=2 236 302 2.0E-06
sp|Q9LX93|ATL55_ARATH E3 ubiquitin-protein ligase RING1 OS=Arabidopsis thaliana GN=ATL55 PE=1 SV=1 236 354 2.0E-06
sp|Q9Y6U7|RN215_HUMAN RING finger protein 215 OS=Homo sapiens GN=RNF215 PE=3 SV=2 237 288 2.0E-06
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 237 292 3.0E-06
sp|Q8LF65|ATL17_ARATH RING-H2 finger protein ATL17 OS=Arabidopsis thaliana GN=ATL17 PE=2 SV=2 217 292 3.0E-06
sp|O64762|ATL38_ARATH RING-H2 finger protein ATL38 OS=Arabidopsis thaliana GN=ATL38 PE=2 SV=1 236 308 3.0E-06
sp|Q9FIR0|ATL30_ARATH RING-H2 finger protein ATL30 OS=Arabidopsis thaliana GN=ATL30 PE=2 SV=1 236 289 3.0E-06
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 237 292 3.0E-06
sp|Q9FGJ6|ATL79_ARATH RING-H2 finger protein ATL79 OS=Arabidopsis thaliana GN=ATL79 PE=2 SV=1 236 300 4.0E-06
sp|Q08D68|ZNRF3_XENTR E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus tropicalis GN=znrf3 PE=1 SV=1 190 290 4.0E-06
sp|Q8GYT9|SIS3_ARATH E3 ubiquitin-protein ligase SIS3 OS=Arabidopsis thaliana GN=SIS3 PE=2 SV=2 176 332 4.0E-06
sp|Q6AY01|RN133_RAT E3 ubiquitin-protein ligase RNF133 OS=Rattus norvegicus GN=Rnf133 PE=2 SV=1 237 340 4.0E-06
sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 237 284 5.0E-06
sp|Q86Y13|DZIP3_HUMAN E3 ubiquitin-protein ligase DZIP3 OS=Homo sapiens GN=DZIP3 PE=1 SV=2 237 299 6.0E-06
sp|Q9H0F5|RNF38_HUMAN E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens GN=RNF38 PE=1 SV=4 180 284 6.0E-06
sp|Q566M8|RN150_DANRE RING finger protein 150 OS=Danio rerio GN=rnf150 PE=2 SV=1 236 296 6.0E-06
sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus GN=Rnf150 PE=2 SV=2 236 294 7.0E-06
sp|Q9ULK6|RN150_HUMAN RING finger protein 150 OS=Homo sapiens GN=RNF150 PE=2 SV=2 236 294 7.0E-06
sp|Q95K04|RN133_MACFA E3 ubiquitin-protein ligase RNF133 OS=Macaca fascicularis GN=RNF133 PE=2 SV=1 237 292 7.0E-06
sp|Q9SRQ8|ATL51_ARATH RING-H2 finger protein ATL51 OS=Arabidopsis thaliana GN=ATL51 PE=2 SV=2 229 340 8.0E-06
sp|Q8BI21|RNF38_MOUSE E3 ubiquitin-protein ligase RNF38 OS=Mus musculus GN=Rnf38 PE=2 SV=1 237 284 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0061630 ubiquitin protein ligase activity Yes
GO:0008270 zinc ion binding Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0005680 anaphase-promoting complex Yes
GO:0097602 cullin family protein binding Yes
GO:0046872 metal ion binding Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0043169 cation binding No
GO:0044248 cellular catabolic process No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0046914 transition metal ion binding No
GO:0005575 cellular_component No
GO:0140535 intracellular protein-containing complex No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0051603 proteolysis involved in protein catabolic process No
GO:1990234 transferase complex No
GO:0019941 modification-dependent protein catabolic process No
GO:0030163 protein catabolic process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0032991 protein-containing complex No
GO:0140096 catalytic activity, acting on a protein No
GO:0044260 cellular macromolecule metabolic process No
GO:0000151 ubiquitin ligase complex No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0044265 cellular macromolecule catabolic process No
GO:0003824 catalytic activity No
GO:0009057 macromolecule catabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0006508 proteolysis No
GO:0004842 ubiquitin-protein transferase activity No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0010498 proteasomal protein catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1902494 catalytic complex No
GO:0005515 protein binding No
GO:0043170 macromolecule metabolic process No
GO:1901575 organic substance catabolic process No
GO:0140513 nuclear protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|004290
MSARSPMWFCHQCHAEMRPLMAPDPVCASCRSSFVEKIEDPQDDPRQFAAPAPAPPPGDHDAAGFDNFLIALQTL
LNRGMDPADQPPPRQQPPSRMTFQFGNVAGHPRQTTVTFGTSPSPPGAVPSMSEFMRSAPSPFPQEDTHATPQIN
GHLFSQYLMSLLGQTNHPMMPLFMGGGMPESGRMGDYVFSQDALDQIITQIMDSTNTNRPVPATEEIVERLPQEV
LMADSPLLTKDCAVCKDQFELGTEDPEQQIVITLPCKHPFHKMCILPWLKSSGTCPVCRYALVPQPGQPTSPNPN
DTTASSSSPRPTANDPRPRSQSPPSSPRQSPRSTTSGSVPARSNFASLFGMGGSPRHFHRPSSSFPQPPTARPSS
PNSRPAERTSSSSRSGSRNDQPRNSGDRRPHFPGQWTDDMSDLD*
Coding >AgabiH97|004290
ATGTCTGCCCGCTCGCCAATGTGGTTCTGCCACCAATGCCACGCTGAAATGCGCCCACTCATGGCCCCAGATCCC
GTCTGCGCTTCCTGTCGCAGCTCCTTTGTCGAAAAGATCGAAGATCCTCAAGACGATCCCCGCCAATTTGCTGCA
CCCGCACCCGCCCCGCCTCCCGGTGACCACGATGCCGCTGGTTTCGACAACTTTCTAATTGCTCTGCAGACCCTT
CTCAACCGTGGAATGGACCCCGCTGATCAACCACCCCCTCGACAACAACCTCCCTCCCGTATGACATTCCAGTTT
GGCAATGTAGCCGGTCACCCTCGACAGACAACAGTCACGTTTGGCACTTCCCCGTCACCCCCAGGTGCCGTACCA
TCCATGTCAGAATTCATGCGTAGTGCTCCCAGCCCTTTCCCCCAAGAGGATACCCACGCCACTCCACAGATCAAC
GGTCATCTCTTTTCTCAGTACCTCATGTCTCTCCTTGGACAAACGAACCATCCTATGATGCCTCTCTTCATGGGC
GGCGGTATGCCAGAGAGTGGTAGAATGGGTGACTATGTCTTCAGTCAAGATGCATTAGATCAAATAATTACGCAA
ATCATGGATTCCACTAATACCAACAGGCCCGTTCCCGCAACCGAAGAGATCGTTGAGCGCCTCCCTCAAGAAGTC
CTCATGGCTGACAGCCCTCTCTTGACCAAGGATTGTGCGGTGTGTAAAGATCAGTTCGAGTTGGGGACAGAAGAC
CCAGAGCAACAGATCGTGATTACTCTCCCATGCAAGCATCCGTTCCACAAGATGTGTATCCTTCCTTGGTTAAAG
TCTTCCGGCACGTGTCCTGTATGTCGATACGCGCTTGTCCCACAGCCTGGGCAGCCTACATCGCCAAACCCCAAC
GACACTACCGCTTCCTCGTCCTCCCCAAGGCCCACCGCCAATGACCCACGCCCAAGATCACAATCACCCCCCAGC
AGTCCACGCCAGTCGCCAAGGTCAACAACATCAGGTTCAGTCCCTGCCCGAAGCAATTTTGCTTCGTTGTTTGGT
ATGGGAGGCAGTCCCAGACACTTCCATCGTCCCTCGAGTTCCTTTCCGCAACCACCCACAGCACGACCGTCGTCA
CCCAACTCCCGACCGGCTGAGCGGACGTCCTCGTCCTCTAGGTCTGGCTCACGCAATGACCAACCACGGAATAGT
GGGGATAGGCGCCCACATTTTCCAGGCCAGTGGACCGATGACATGTCGGATTTAGATTGA
Transcript >AgabiH97|004290
ATGTCTGCCCGCTCGCCAATGTGGTTCTGCCACCAATGCCACGCTGAAATGCGCCCACTCATGGCCCCAGATCCC
GTCTGCGCTTCCTGTCGCAGCTCCTTTGTCGAAAAGATCGAAGATCCTCAAGACGATCCCCGCCAATTTGCTGCA
CCCGCACCCGCCCCGCCTCCCGGTGACCACGATGCCGCTGGTTTCGACAACTTTCTAATTGCTCTGCAGACCCTT
CTCAACCGTGGAATGGACCCCGCTGATCAACCACCCCCTCGACAACAACCTCCCTCCCGTATGACATTCCAGTTT
GGCAATGTAGCCGGTCACCCTCGACAGACAACAGTCACGTTTGGCACTTCCCCGTCACCCCCAGGTGCCGTACCA
TCCATGTCAGAATTCATGCGTAGTGCTCCCAGCCCTTTCCCCCAAGAGGATACCCACGCCACTCCACAGATCAAC
GGTCATCTCTTTTCTCAGTACCTCATGTCTCTCCTTGGACAAACGAACCATCCTATGATGCCTCTCTTCATGGGC
GGCGGTATGCCAGAGAGTGGTAGAATGGGTGACTATGTCTTCAGTCAAGATGCATTAGATCAAATAATTACGCAA
ATCATGGATTCCACTAATACCAACAGGCCCGTTCCCGCAACCGAAGAGATCGTTGAGCGCCTCCCTCAAGAAGTC
CTCATGGCTGACAGCCCTCTCTTGACCAAGGATTGTGCGGTGTGTAAAGATCAGTTCGAGTTGGGGACAGAAGAC
CCAGAGCAACAGATCGTGATTACTCTCCCATGCAAGCATCCGTTCCACAAGATGTGTATCCTTCCTTGGTTAAAG
TCTTCCGGCACGTGTCCTGTATGTCGATACGCGCTTGTCCCACAGCCTGGGCAGCCTACATCGCCAAACCCCAAC
GACACTACCGCTTCCTCGTCCTCCCCAAGGCCCACCGCCAATGACCCACGCCCAAGATCACAATCACCCCCCAGC
AGTCCACGCCAGTCGCCAAGGTCAACAACATCAGGTTCAGTCCCTGCCCGAAGCAATTTTGCTTCGTTGTTTGGT
ATGGGAGGCAGTCCCAGACACTTCCATCGTCCCTCGAGTTCCTTTCCGCAACCACCCACAGCACGACCGTCGTCA
CCCAACTCCCGACCGGCTGAGCGGACGTCCTCGTCCTCTAGGTCTGGCTCACGCAATGACCAACCACGGAATAGT
GGGGATAGGCGCCCACATTTTCCAGGCCAGTGGACCGATGACATGTCGGATTTAGATTGA
Gene >AgabiH97|004290
ATGTCTGCCCGCTCGCCAATGTGGTTCTGCCACCAAGTGCGTCGACTCTCTCGTCCCCGTGACCCCCAGCTCATT
CTCCCCCCTCAGTGCCACGCTGAAATGCGCCCACTCATGGTCTCTCTCACTCGCTGATCCTCCCCTGCACTGACT
AATCAACCCTGCAGGCCCCAGATCCCGTCTGCGCTTCCTGTCGCAGCTCCTTTGTCGAAAAGGTGGCTGCTTTCC
TGCTCTCTCACTCTCGCTTGCCTCACCACCCCACCAGATCGAAGATCCTCAAGACGATCCCCGCCAATTTGCTGC
ACCCGCACCCGCCCCGCCTCCCGGTGACCACGATGCCGCTGGTTTCGACAACTTTCTAAGTGTGTTCATTCCAAG
CACTTTTGTCTCTGCTACATCTCTCTTTCAGTTGCTCTGCAGACCCTTCTCAACCGTGGAATGGACCCCGCTGAT
CAACCACCCCCTCGACAACAAGTGAATCTCTGCTGTTCTATCTCGTTTCTCGACACTCAGACCTTCCTTTCTAGC
CTCCCTCCCGTATGACATTCCAGTTTGGCAATGTAGCCGGTCACCCTCGACAGACAACAGTCACGTTTGGCACTT
CCCCGTCACCCCCAGGTGCCGTACCATCCATGTCAGAGTAGGTGTCTTTTCCCATATCATCCTCCGGCTCCACCG
ACCTTGTGCCCCAGATTCATGCGTAGTGCTCCCAGCCCTTTCCCCCAAGAGGATACCCACGCCACTCCACAGATC
AACGGTCATCTCTTTTCTCAGTACCTCATGTCTCTCCTTGGACAAACGAACCATCCTATGATGCCTCTCTTCATG
GGCGGCGGTATGCCAGAGAGTGGTAGAATGGGTGACTATGTCTTCAGTCAAGATGGTATGTATGCCCTCTCTTGA
CTTTTCCATCTGTCCTCATGTCCTGCTCAGCATTAGATCAAATAATTACGCAAATCATGGATTCCACTAATACCA
ACAGGCCCGTTCCCGCAACCGAAGAGATCGTTGAGCGCCTCCCTCAAGAAGTCCTCATGGCTGACAGTACGTTCA
TCTCTGCTCTCTTTCTCACACGCACCCTCATTCCTTCTAGGCCCTCTCTTGACCAAGGATTGTGCGGTGTGTAAA
GATCAGTTCGAGTTGGGGACAGAAGACCCAGAGCAACAGATCGTGATTACTCTCCCATGCAAGCATCCGTTCCAC
AAGATGTGTATCCTTCCTTGGTTAAAGTCTTCCGGCACGTGTCCTGTATGTCGATACGCGCTTGTCCCACAGCCT
GGGCAGCCTACATCGCCAAACCCCAACGACACTACCGCTTCCTCGTCCTCCCCAAGGCCCACCGCCAATGACCCA
CGCCCAAGATCACAATCACCCCCCAGCAGTCCACGCCAGTCGCCAAGGTCAACAACATCAGGTTCAGTCCCTGCC
CGAAGCAATTTTGCTTCGTTGTTTGGTATGGGAGGCAGTCCCAGACACTTCCATCGTCCCTCGAGTTCCTTTCCG
CAACCACCCACAGCACGACCGTCGTCACCCAACTCCCGACCGGCTGAGCGGACGTCCTCGTCCTCTAGGTCTGGC
TCACGCAATGACCAACCACGGAATAGTGGGGATAGGCGCCCACATTTTCCAGGCCAGTGGACCGATGACATGTCG
GATTTAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail