Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|004240
Gene name
Locationscaffold_1:1041828..1042904
Strand-
Gene length (bp)1076
Transcript length (bp)708
Coding sequence length (bp)708
Protein length (aa) 236

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12352 V-SNARE_C Snare region anchored in the vesicle membrane C-terminus 4.6E-13 134 199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2TBU3|GOSR1_BOVIN Golgi SNAP receptor complex member 1 OS=Bos taurus GN=GOSR1 PE=2 SV=1 4 218 6.0E-35
sp|O95249|GOSR1_HUMAN Golgi SNAP receptor complex member 1 OS=Homo sapiens GN=GOSR1 PE=1 SV=1 4 218 8.0E-35
sp|O08522|GOSR1_CRIGR Golgi SNAP receptor complex member 1 OS=Cricetulus griseus GN=GOSR1 PE=1 SV=1 4 218 9.0E-35
sp|O22151|GOS12_ARATH Golgi SNAP receptor complex member 1-2 OS=Arabidopsis thaliana GN=GOS12 PE=1 SV=2 2 221 1.0E-34
sp|Q62931|GOSR1_RAT Golgi SNAP receptor complex member 1 OS=Rattus norvegicus GN=Gosr1 PE=1 SV=1 4 218 1.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2TBU3|GOSR1_BOVIN Golgi SNAP receptor complex member 1 OS=Bos taurus GN=GOSR1 PE=2 SV=1 4 218 6.0E-35
sp|O95249|GOSR1_HUMAN Golgi SNAP receptor complex member 1 OS=Homo sapiens GN=GOSR1 PE=1 SV=1 4 218 8.0E-35
sp|O08522|GOSR1_CRIGR Golgi SNAP receptor complex member 1 OS=Cricetulus griseus GN=GOSR1 PE=1 SV=1 4 218 9.0E-35
sp|O22151|GOS12_ARATH Golgi SNAP receptor complex member 1-2 OS=Arabidopsis thaliana GN=GOS12 PE=1 SV=2 2 221 1.0E-34
sp|Q62931|GOSR1_RAT Golgi SNAP receptor complex member 1 OS=Rattus norvegicus GN=Gosr1 PE=1 SV=1 4 218 1.0E-34
sp|Q5RBL6|GOSR1_PONAB Golgi SNAP receptor complex member 1 OS=Pongo abelii GN=GOSR1 PE=2 SV=1 4 218 2.0E-34
sp|O88630|GOSR1_MOUSE Golgi SNAP receptor complex member 1 OS=Mus musculus GN=Gosr1 PE=1 SV=2 4 218 2.0E-34
sp|Q9LMP7|GOS11_ARATH Golgi SNAP receptor complex member 1-1 OS=Arabidopsis thaliana GN=GOS11 PE=2 SV=1 2 221 4.0E-24
sp|Q9VE50|GOSR1_DROME Golgi SNAP receptor complex member 1 OS=Drosophila melanogaster GN=Gos28 PE=2 SV=1 2 218 8.0E-24
sp|P38736|GOSR1_YEAST Golgi SNAP receptor complex member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GOS1 PE=1 SV=1 13 218 1.0E-23
sp|Q95ZW1|GOSR1_CAEEL Golgi SNAP receptor complex member 1 OS=Caenorhabditis elegans GN=gos-28 PE=2 SV=1 3 218 6.0E-18
sp|A8XLW0|GOSR1_CAEBR Golgi SNAP receptor complex member 1 OS=Caenorhabditis briggsae GN=gos-28 PE=3 SV=1 3 218 1.0E-17
sp|Q09835|GOS1_SCHPO Protein transport protein gos1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gos1 PE=3 SV=1 137 218 6.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 204 226 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|004240
MTTYDRLHRQCRTLENLFDSKLTTYAQLAATLAQPEQDVEASGSSNRWKDLEQELDDLLLKLEEINEQLSTLASN
PDILSASMLRTIQRHRELFQDNSRELNRTKTNIHAALDKASLLSGVRNDIDAYKSSAGESLLAERGRIDNSHRMT
DDILAQAYETRSEFSRQRTSISSVNARMVGVINKMPGINNLVGMIKSRRRRDSIILGLLIGICTIIILSHFGLYS
SMLLYVYPLF*
Coding >AgabiH97|004240
ATGACGACGTACGACAGACTACACAGGCAGTGTCGAACACTCGAAAATCTTTTTGACTCGAAACTTACCACATAC
GCTCAACTTGCAGCTACTCTTGCACAACCGGAACAGGATGTTGAAGCTTCAGGTTCAAGCAACCGTTGGAAGGAC
TTGGAGCAAGAATTGGACGACCTCTTGTTAAAGCTGGAAGAAATCAACGAACAGCTTTCGACATTAGCCAGTAAT
CCTGATATACTATCAGCCTCAATGCTTCGAACCATCCAACGGCACCGGGAATTATTCCAGGATAACTCGCGAGAA
CTTAATCGAACAAAGACAAATATTCACGCTGCCCTCGATAAAGCCAGTCTACTGAGCGGAGTACGAAACGATATC
GATGCCTACAAATCATCTGCAGGAGAGTCGTTGCTGGCAGAAAGAGGAAGGATAGACAATTCACACAGGATGACA
GACGATATTTTAGCTCAAGCATACGAAACACGTTCCGAATTCTCACGTCAGAGAACAAGCATTTCCAGCGTGAAT
GCTCGGATGGTGGGAGTCATCAATAAAATGCCAGGAATCAACAACCTTGTCGGCATGATTAAATCCAGACGACGT
CGAGATTCTATCATTTTGGGGCTCTTGATTGGAATTTGCACGATCATCATTCTTTCGCATTTTGGTTTATATTCA
AGCATGCTACTTTATGTTTATCCTTTGTTCTAA
Transcript >AgabiH97|004240
ATGACGACGTACGACAGACTACACAGGCAGTGTCGAACACTCGAAAATCTTTTTGACTCGAAACTTACCACATAC
GCTCAACTTGCAGCTACTCTTGCACAACCGGAACAGGATGTTGAAGCTTCAGGTTCAAGCAACCGTTGGAAGGAC
TTGGAGCAAGAATTGGACGACCTCTTGTTAAAGCTGGAAGAAATCAACGAACAGCTTTCGACATTAGCCAGTAAT
CCTGATATACTATCAGCCTCAATGCTTCGAACCATCCAACGGCACCGGGAATTATTCCAGGATAACTCGCGAGAA
CTTAATCGAACAAAGACAAATATTCACGCTGCCCTCGATAAAGCCAGTCTACTGAGCGGAGTACGAAACGATATC
GATGCCTACAAATCATCTGCAGGAGAGTCGTTGCTGGCAGAAAGAGGAAGGATAGACAATTCACACAGGATGACA
GACGATATTTTAGCTCAAGCATACGAAACACGTTCCGAATTCTCACGTCAGAGAACAAGCATTTCCAGCGTGAAT
GCTCGGATGGTGGGAGTCATCAATAAAATGCCAGGAATCAACAACCTTGTCGGCATGATTAAATCCAGACGACGT
CGAGATTCTATCATTTTGGGGCTCTTGATTGGAATTTGCACGATCATCATTCTTTCGCATTTTGGTTTATATTCA
AGCATGCTACTTTATGTTTATCCTTTGTTCTAA
Gene >AgabiH97|004240
ATGACGACGTACGACAGACTACACAGGCAGTGTCGAACACTCGAAAATCTTTTTGACTCGAAACTTACCACATAC
GCTCAACTTGCAGCTACTCTTGCACAACCGGAACAGGATGTTGAAGCTTCAGGTTCAAGCAACCGTTGGAAGGAC
TTGGAGCAAGAATTGGACGACCTCTTGTTAAAGGTACGAACCTATACTCGCATGATTGGGTGGTCGTTAACGCAA
CCAAATAGCTGGAAGAAATCAACGAACAGCTTTCGACATTAGCCAGTAATCCTGATATACTATCAGCCTCAATGC
TTCGAACCATCCAACGGCACCGGGAATTATTCCAGGATAACTCGCGAGAACTTAATCGAACAAAGGCGCGAGCTT
GACTTACCTTCATATCCTTCATATAACAACTTATACTTCCAGACAAATATTCACGCTGCCCTCGATAAAGCCAGT
CTACTGAGCGGAGTACGAAACGATATCGAGTGCGCCAAAATCCTTTCTTTTCAAAGCTGTGATTTGACGAATTGC
CTAGTGCCTACAAATCATCTGCAGGAGAGTCGTTGCTGGCAGAAAGAGGAAGGATAGACAATTCACACAGGATGA
CAGACGATATTTTAGCGTGCGTCGTTCTGTAATTTTATTTTCCATCGTGGTACTTATATCCGCTAAGTCAAGCAT
ACGAAACACGTTCCGAATTCTCACGTCAGAGAACAAGCATTTCCAGCGTGAATGCTCGGATGGTGGGAGTCATCA
GTGAGCATATATGTTAAGACTCACACCTGAAATTTCTGAAGCATGGTTTGTAGATAAAATGCCAGGAATCAACAA
CCTTGTCGGCATGATTAAATCCAGACGACGTCGAGATTCTATCATTTTGGGGCTCTTGATTGGAATTTGCACGAT
CATCATTCTTTCGTATGTATGGAATTGACCGGTCTTAACTCATGACTACTGCCTTCGGTCATTTTCCATTTCTAG
GCATTTTGGTTTATATTCAAGCATGCGTGAGTAATTGCAAGGTTTTCGTTATATTCAGACTAACCATTATCACAG
TACTTTATGTTTATCCTTTGTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail