Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|004180
Gene name
Locationscaffold_1:1030051..1032116
Strand+
Gene length (bp)2065
Transcript length (bp)1749
Coding sequence length (bp)1749
Protein length (aa) 583

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01967 MoaC MoaC family 2.8E-48 412 573
PF06463 Mob_synth_C Molybdenum Cofactor Synthesis C 2.3E-38 222 348
PF04055 Radical_SAM Radical SAM superfamily 1.1E-26 53 216
PF13353 Fer4_12 4Fe-4S single cluster domain 1.5E-05 57 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RKZ7|MOCS1_MOUSE Molybdenum cofactor biosynthesis protein 1 OS=Mus musculus GN=Mocs1 PE=1 SV=2 35 580 4.0E-154
sp|Q9NZB8|MOCS1_HUMAN Molybdenum cofactor biosynthesis protein 1 OS=Homo sapiens GN=MOCS1 PE=1 SV=3 35 580 4.0E-154
sp|Q20624|MOCS1_CAEEL Molybdenum cofactor biosynthesis protein 1 OS=Caenorhabditis elegans GN=F49E2.1 PE=3 SV=3 26 575 1.0E-141
sp|Q8IQF1|MOCS1_DROME Molybdenum cofactor biosynthesis protein 1 OS=Drosophila melanogaster GN=Mocs1 PE=2 SV=1 28 574 2.0E-141
sp|Q54NM6|MOCS1_DICDI Molybdenum cofactor biosynthesis protein 1 OS=Dictyostelium discoideum GN=mocs1 PE=3 SV=1 42 577 7.0E-139
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5RKZ7|MOCS1_MOUSE Molybdenum cofactor biosynthesis protein 1 OS=Mus musculus GN=Mocs1 PE=1 SV=2 35 580 4.0E-154
sp|Q9NZB8|MOCS1_HUMAN Molybdenum cofactor biosynthesis protein 1 OS=Homo sapiens GN=MOCS1 PE=1 SV=3 35 580 4.0E-154
sp|Q20624|MOCS1_CAEEL Molybdenum cofactor biosynthesis protein 1 OS=Caenorhabditis elegans GN=F49E2.1 PE=3 SV=3 26 575 1.0E-141
sp|Q8IQF1|MOCS1_DROME Molybdenum cofactor biosynthesis protein 1 OS=Drosophila melanogaster GN=Mocs1 PE=2 SV=1 28 574 2.0E-141
sp|Q54NM6|MOCS1_DICDI Molybdenum cofactor biosynthesis protein 1 OS=Dictyostelium discoideum GN=mocs1 PE=3 SV=1 42 577 7.0E-139
sp|Q39055|CNX2_ARATH Cyclic pyranopterin monophosphate synthase, mitochondrial OS=Arabidopsis thaliana GN=CNX2 PE=1 SV=1 35 365 8.0E-132
sp|Q1JQD7|MOCS1_BOVIN Molybdenum cofactor biosynthesis protein 1 OS=Bos taurus GN=MOCS1 PE=2 SV=2 27 580 5.0E-127
sp|Q0AVU6|MOAA_SYNWW Cyclic pyranopterin monophosphate synthase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=moaA PE=3 SV=1 41 365 1.0E-76
sp|Q7UT69|MOAA_RHOBA Cyclic pyranopterin monophosphate synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=moaA PE=3 SV=1 19 365 1.0E-76
sp|Q2RGL2|MOAA_MOOTA Cyclic pyranopterin monophosphate synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=moaA PE=3 SV=1 42 347 2.0E-73
sp|B5YJ09|MOAA_THEYD Cyclic pyranopterin monophosphate synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=moaA PE=3 SV=1 42 365 9.0E-73
sp|A4J6S5|MOAA_DESRM Cyclic pyranopterin monophosphate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=moaA PE=3 SV=1 41 347 2.0E-72
sp|A8MLW5|MOAA_ALKOO Cyclic pyranopterin monophosphate synthase OS=Alkaliphilus oremlandii (strain OhILAs) GN=moaA PE=3 SV=1 42 365 2.0E-71
sp|A5CYZ0|MOAA_PELTS Cyclic pyranopterin monophosphate synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=moaA PE=3 SV=1 42 347 2.0E-70
sp|A0AHG0|MOAA_LISW6 Cyclic pyranopterin monophosphate synthase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=moaA PE=3 SV=1 42 360 5.0E-70
sp|Q8Y870|MOAA_LISMO Cyclic pyranopterin monophosphate synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=moaA PE=3 SV=1 42 360 7.0E-70
sp|C1L1W8|MOAA_LISMC Cyclic pyranopterin monophosphate synthase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=moaA PE=3 SV=1 42 360 2.0E-69
sp|Q721B9|MOAA_LISMF Cyclic pyranopterin monophosphate synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=moaA PE=3 SV=1 42 360 3.0E-69
sp|Q92CY2|MOAA_LISIN Cyclic pyranopterin monophosphate synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=moaA PE=3 SV=1 42 360 7.0E-69
sp|Q93KD1|MOAA_EUBAC Cyclic pyranopterin monophosphate synthase OS=Eubacterium acidaminophilum GN=moaA PE=3 SV=2 40 348 1.0E-68
sp|Q3ADX8|MOAA_CARHZ Cyclic pyranopterin monophosphate synthase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=moaA PE=3 SV=1 41 351 2.0E-68
sp|Q9RJ47|MOAA_STRCO Cyclic pyranopterin monophosphate synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=moaA PE=3 SV=1 40 365 3.0E-68
sp|Q747W9|MOAA_GEOSL Cyclic pyranopterin monophosphate synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=moaA PE=3 SV=1 39 352 1.0E-67
sp|B0TI16|MOAA_HELMI Cyclic pyranopterin monophosphate synthase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=moaA PE=3 SV=1 40 352 2.0E-67
sp|A6TVF9|MOAA_ALKMQ Cyclic pyranopterin monophosphate synthase OS=Alkaliphilus metalliredigens (strain QYMF) GN=moaA PE=3 SV=1 42 347 7.0E-66
sp|Q8NR60|MOAA_CORGL Cyclic pyranopterin monophosphate synthase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=moaA PE=3 SV=1 40 365 3.0E-65
sp|Q9WX96|MOAA_CLOPE Cyclic pyranopterin monophosphate synthase OS=Clostridium perfringens (strain 13 / Type A) GN=moaA PE=3 SV=2 42 347 1.0E-64
sp|Q0SS32|MOAA_CLOPS Cyclic pyranopterin monophosphate synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=moaA PE=3 SV=1 42 347 1.0E-64
sp|A4QDF8|MOAA_CORGB Cyclic pyranopterin monophosphate synthase OS=Corynebacterium glutamicum (strain R) GN=moaA PE=3 SV=1 40 365 2.0E-64
sp|Q0TPG6|MOAA_CLOP1 Cyclic pyranopterin monophosphate synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=moaA PE=3 SV=1 42 347 3.0E-64
sp|Q88WY1|MOAA_LACPL Cyclic pyranopterin monophosphate synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=moaA PE=3 SV=1 39 347 3.0E-64
sp|B2GCN4|MOAA_LACF3 Cyclic pyranopterin monophosphate synthase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=moaA PE=3 SV=1 39 319 2.0E-62
sp|B1KU20|MOAA_CLOBM Cyclic pyranopterin monophosphate synthase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=moaA PE=3 SV=1 40 365 3.0E-62
sp|Q1B3F3|MOAA_MYCSS Cyclic pyranopterin monophosphate synthase OS=Mycobacterium sp. (strain MCS) GN=moaA PE=3 SV=1 35 365 9.0E-62
sp|A1ULP7|MOAA_MYCSK Cyclic pyranopterin monophosphate synthase OS=Mycobacterium sp. (strain KMS) GN=moaA PE=3 SV=1 35 365 9.0E-62
sp|A3Q648|MOAA_MYCSJ Cyclic pyranopterin monophosphate synthase OS=Mycobacterium sp. (strain JLS) GN=moaA PE=3 SV=1 35 365 9.0E-62
sp|C1FPG7|MOAA_CLOBJ Cyclic pyranopterin monophosphate synthase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=moaA PE=3 SV=1 40 365 2.0E-61
sp|A5I365|MOAA_CLOBH Cyclic pyranopterin monophosphate synthase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=moaA PE=3 SV=1 40 365 2.0E-61
sp|A7FUZ6|MOAA_CLOB1 Cyclic pyranopterin monophosphate synthase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=moaA PE=3 SV=1 40 365 2.0E-61
sp|A9BF51|MOAA_PETMO Cyclic pyranopterin monophosphate synthase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=moaA PE=3 SV=1 41 321 3.0E-61
sp|B1IN35|MOAA_CLOBK Cyclic pyranopterin monophosphate synthase OS=Clostridium botulinum (strain Okra / Type B1) GN=moaA PE=3 SV=1 40 365 4.0E-61
sp|A7GEQ5|MOAA_CLOBL Cyclic pyranopterin monophosphate synthase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=moaA PE=3 SV=1 40 365 5.0E-61
sp|Q31JB9|MOAA_THICR Cyclic pyranopterin monophosphate synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=moaA PE=3 SV=1 40 365 4.0E-60
sp|C3KXJ8|MOAA_CLOB6 Cyclic pyranopterin monophosphate synthase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=moaA PE=3 SV=1 40 365 6.0E-60
sp|A7GU01|MOAA_BACCN Cyclic pyranopterin monophosphate synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=moaA PE=3 SV=1 42 366 7.0E-60
sp|A4XW05|MOAA_PSEMY Cyclic pyranopterin monophosphate synthase OS=Pseudomonas mendocina (strain ymp) GN=moaA PE=3 SV=1 37 365 2.0E-59
sp|Q4L8D2|MOAA_STAHJ Cyclic pyranopterin monophosphate synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=moaA PE=3 SV=1 37 332 4.0E-59
sp|C6C060|MOAA_DESAD Cyclic pyranopterin monophosphate synthase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=moaA PE=3 SV=1 42 343 6.0E-59
sp|Q44118|MOAA_ARTNI Cyclic pyranopterin monophosphate synthase OS=Arthrobacter nicotinovorans GN=moaA PE=1 SV=2 40 365 9.0E-59
sp|B0CDZ6|MOAA_ACAM1 Cyclic pyranopterin monophosphate synthase OS=Acaryochloris marina (strain MBIC 11017) GN=moaA PE=3 SV=1 50 365 2.0E-58
sp|A5VQC9|MOAA_BRUO2 Cyclic pyranopterin monophosphate synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=moaA PE=3 SV=1 37 362 2.0E-58
sp|B2HFA4|MOAA_MYCMM Cyclic pyranopterin monophosphate synthase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=moaA PE=3 SV=1 21 365 2.0E-58
sp|P9WJS1|MOAA2_MYCTU Cyclic pyranopterin monophosphate synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moaA2 PE=1 SV=1 15 365 2.0E-58
sp|P9WJS0|MOAA2_MYCTO Cyclic pyranopterin monophosphate synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moaA2 PE=3 SV=1 15 365 2.0E-58
sp|P65385|MOAA2_MYCBO Cyclic pyranopterin monophosphate synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=moaA2 PE=3 SV=1 15 365 2.0E-58
sp|Q8G0X4|MOAA_BRUSU Cyclic pyranopterin monophosphate synthase OS=Brucella suis biovar 1 (strain 1330) GN=moaA PE=3 SV=1 37 362 3.0E-58
sp|B0CLT0|MOAA_BRUSI Cyclic pyranopterin monophosphate synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=moaA PE=3 SV=1 37 362 3.0E-58
sp|A9MAX5|MOAA_BRUC2 Cyclic pyranopterin monophosphate synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=moaA PE=3 SV=1 37 362 3.0E-58
sp|Q57DG3|MOAA_BRUAB Cyclic pyranopterin monophosphate synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=moaA PE=3 SV=1 37 362 4.0E-58
sp|Q2YNT7|MOAA_BRUA2 Cyclic pyranopterin monophosphate synthase OS=Brucella abortus (strain 2308) GN=moaA PE=3 SV=1 37 362 4.0E-58
sp|B2S5I1|MOAA_BRUA1 Cyclic pyranopterin monophosphate synthase OS=Brucella abortus (strain S19) GN=moaA PE=3 SV=1 37 362 4.0E-58
sp|Q0S2N2|MOAA_RHOJR Cyclic pyranopterin monophosphate synthase OS=Rhodococcus jostii (strain RHA1) GN=moaA PE=3 SV=1 26 348 6.0E-58
sp|Q56211|MOAA_SYNE7 Cyclic pyranopterin monophosphate synthase OS=Synechococcus elongatus (strain PCC 7942) GN=moaA PE=3 SV=1 42 347 6.0E-58
sp|Q8YGY6|MOAA_BRUME Cyclic pyranopterin monophosphate synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=moaA PE=3 SV=1 37 362 6.0E-58
sp|C0RIT4|MOAA_BRUMB Cyclic pyranopterin monophosphate synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=moaA PE=3 SV=1 37 362 6.0E-58
sp|Q5N5F7|MOAA_SYNP6 Cyclic pyranopterin monophosphate synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=moaA PE=3 SV=1 42 347 8.0E-58
sp|Q9ZIM6|MOAA_STACT Cyclic pyranopterin monophosphate synthase OS=Staphylococcus carnosus (strain TM300) GN=moaA PE=3 SV=1 39 332 1.0E-57
sp|A0PKZ7|MOAA_MYCUA Cyclic pyranopterin monophosphate synthase OS=Mycobacterium ulcerans (strain Agy99) GN=moaA PE=3 SV=1 21 365 1.0E-57
sp|B8HWW4|MOAA_CYAP4 Cyclic pyranopterin monophosphate synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=moaA PE=3 SV=1 50 352 2.0E-57
sp|A1U578|MOAA_MARHV Cyclic pyranopterin monophosphate synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=moaA PE=3 SV=1 39 365 2.0E-57
sp|Q119N9|MOAA_TRIEI Cyclic pyranopterin monophosphate synthase OS=Trichodesmium erythraeum (strain IMS101) GN=moaA PE=3 SV=1 50 337 3.0E-57
sp|B1XLR4|MOAA_SYNP2 Cyclic pyranopterin monophosphate synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=moaA PE=3 SV=1 50 359 5.0E-57
sp|C1B1N5|MOAA_RHOOB Cyclic pyranopterin monophosphate synthase OS=Rhodococcus opacus (strain B4) GN=moaA PE=3 SV=1 34 348 1.0E-56
sp|Q1I6J5|MOAA_PSEE4 Cyclic pyranopterin monophosphate synthase OS=Pseudomonas entomophila (strain L48) GN=moaA PE=3 SV=1 40 347 1.0E-56
sp|Q65DY5|MOAA_BACLD Cyclic pyranopterin monophosphate synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=moaA PE=3 SV=1 39 336 1.0E-56
sp|B1JCW0|MOAA_PSEPW Cyclic pyranopterin monophosphate synthase OS=Pseudomonas putida (strain W619) GN=moaA PE=3 SV=1 40 365 4.0E-56
sp|Q2JI46|MOAA_SYNJB Cyclic pyranopterin monophosphate synthase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=moaA PE=3 SV=1 49 338 4.0E-56
sp|B4SL67|MOAA_STRM5 Cyclic pyranopterin monophosphate synthase OS=Stenotrophomonas maltophilia (strain R551-3) GN=moaA PE=3 SV=1 39 348 2.0E-55
sp|B0JNC2|MOAA_MICAN Cyclic pyranopterin monophosphate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=moaA PE=3 SV=1 50 340 3.0E-55
sp|Q2K7L4|MOAA_RHIEC Cyclic pyranopterin monophosphate synthase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=moaA PE=3 SV=1 24 362 3.0E-55
sp|A0L7R4|MOAA_MAGMM Cyclic pyranopterin monophosphate synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=moaA PE=3 SV=1 40 347 3.0E-55
sp|B3PQ08|MOAA_RHIE6 Cyclic pyranopterin monophosphate synthase OS=Rhizobium etli (strain CIAT 652) GN=moaA PE=3 SV=1 26 362 3.0E-55
sp|B0KST1|MOAA_PSEPG Cyclic pyranopterin monophosphate synthase OS=Pseudomonas putida (strain GB-1) GN=moaA PE=3 SV=1 40 334 4.0E-55
sp|Q9AC48|MOAA_CAUCR Cyclic pyranopterin monophosphate synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=moaA PE=3 SV=1 32 347 6.0E-55
sp|B9L851|MOAA_NAUPA Cyclic pyranopterin monophosphate synthase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=moaA PE=3 SV=1 41 352 7.0E-55
sp|Q8CNE6|MOAA_STAES Cyclic pyranopterin monophosphate synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=moaA PE=3 SV=1 51 332 7.0E-55
sp|Q5HLY1|MOAA_STAEQ Cyclic pyranopterin monophosphate synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=moaA PE=3 SV=1 51 332 7.0E-55
sp|B2FUM0|MOAA_STRMK Cyclic pyranopterin monophosphate synthase OS=Stenotrophomonas maltophilia (strain K279a) GN=moaA PE=3 SV=1 39 348 8.0E-55
sp|Q1QN98|MOAA_NITHX Cyclic pyranopterin monophosphate synthase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=moaA PE=3 SV=1 39 362 1.0E-54
sp|Q3MC34|MOAA_ANAVT Cyclic pyranopterin monophosphate synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=moaA PE=3 SV=1 50 352 1.0E-54
sp|Q6GEG6|MOAA_STAAR Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain MRSA252) GN=moaA PE=3 SV=1 39 332 1.0E-54
sp|Q931G4|MOAA_STAAM Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=moaA PE=3 SV=1 39 332 2.0E-54
sp|A7X5J1|MOAA_STAA1 Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=moaA PE=3 SV=1 39 332 2.0E-54
sp|Q48HV8|MOAA_PSE14 Cyclic pyranopterin monophosphate synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=moaA PE=3 SV=1 40 334 2.0E-54
sp|Q8UER0|MOAA_AGRFC Cyclic pyranopterin monophosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=moaA PE=3 SV=1 40 362 2.0E-54
sp|P65389|MOAA_STAAW Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain MW2) GN=moaA PE=3 SV=1 39 332 2.0E-54
sp|A8Z366|MOAA_STAAT Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=moaA PE=3 SV=1 39 332 2.0E-54
sp|Q6G754|MOAA_STAAS Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain MSSA476) GN=moaA PE=3 SV=1 39 332 2.0E-54
sp|P65388|MOAA_STAAN Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain N315) GN=moaA PE=3 SV=1 39 332 2.0E-54
sp|A6QJA8|MOAA_STAAE Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain Newman) GN=moaA PE=3 SV=1 39 332 2.0E-54
sp|Q5HDT9|MOAA_STAAC Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain COL) GN=moaA PE=3 SV=1 39 332 2.0E-54
sp|A5IV50|MOAA_STAA9 Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain JH9) GN=moaA PE=3 SV=1 39 332 2.0E-54
sp|P69848|MOAA_STAA8 Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=moaA PE=1 SV=1 39 332 2.0E-54
sp|Q2FEM4|MOAA_STAA3 Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain USA300) GN=moaA PE=3 SV=1 39 332 2.0E-54
sp|A6U3Z2|MOAA_STAA2 Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain JH1) GN=moaA PE=3 SV=1 39 332 2.0E-54
sp|Q3STB0|MOAA_NITWN Cyclic pyranopterin monophosphate synthase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=moaA PE=3 SV=1 39 362 4.0E-54
sp|Q4ZU05|MOAA_PSEU2 Cyclic pyranopterin monophosphate synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=moaA PE=3 SV=1 40 334 4.0E-54
sp|Q8ZGW5|MOAA_YERPE Cyclic pyranopterin monophosphate synthase OS=Yersinia pestis GN=moaA PE=3 SV=1 39 347 5.0E-54
sp|Q8YQG6|MOAA_NOSS1 Cyclic pyranopterin monophosphate synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=moaA PE=3 SV=1 50 352 6.0E-54
sp|Q9HXD6|MOAA1_PSEAE Cyclic pyranopterin monophosphate synthase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=moaA1 PE=3 SV=1 40 365 7.0E-54
sp|A0R443|MOAA_MYCS2 Cyclic pyranopterin monophosphate synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=moaA PE=3 SV=1 32 365 8.0E-54
sp|B7JWW6|MOAA_CYAP8 Cyclic pyranopterin monophosphate synthase OS=Cyanothece sp. (strain PCC 8801) GN=moaA PE=3 SV=1 50 343 8.0E-54
sp|B2J1M7|MOAA_NOSP7 Cyclic pyranopterin monophosphate synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=moaA PE=3 SV=1 50 365 1.0E-53
sp|A6U9U3|MOAA_SINMW Cyclic pyranopterin monophosphate synthase OS=Sinorhizobium medicae (strain WSM419) GN=moaA PE=3 SV=1 30 362 1.0E-53
sp|Q65TT2|MOAA_MANSM Cyclic pyranopterin monophosphate synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=moaA PE=3 SV=1 37 347 1.0E-53
sp|P59038|MOAA_CHLTE Cyclic pyranopterin monophosphate synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=moaA PE=3 SV=1 42 365 2.0E-53
sp|P45311|MOAA_HAEIN Cyclic pyranopterin monophosphate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=moaA PE=3 SV=1 39 347 3.0E-53
sp|Q3KAS8|MOAA_PSEPF Cyclic pyranopterin monophosphate synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=moaA PE=3 SV=1 40 365 3.0E-53
sp|Q882V6|MOAA_PSESM Cyclic pyranopterin monophosphate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=moaA PE=3 SV=1 40 334 5.0E-53
sp|Q88E69|MOAA_PSEPK Cyclic pyranopterin monophosphate synthase OS=Pseudomonas putida (strain KT2440) GN=moaA PE=3 SV=1 40 365 6.0E-53
sp|A5VZZ2|MOAA_PSEP1 Cyclic pyranopterin monophosphate synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=moaA PE=3 SV=1 40 365 6.0E-53
sp|Q2YYS8|MOAA_STAAB Cyclic pyranopterin monophosphate synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=moaA PE=3 SV=1 39 332 1.0E-52
sp|Q4QJR9|MOAA_HAEI8 Cyclic pyranopterin monophosphate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=moaA PE=3 SV=1 39 347 1.0E-52
sp|B5ZRM8|MOAA_RHILW Cyclic pyranopterin monophosphate synthase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=moaA PE=3 SV=1 40 362 2.0E-52
sp|A1SWQ3|MOAA_PSYIN Cyclic pyranopterin monophosphate synthase OS=Psychromonas ingrahamii (strain 37) GN=moaA PE=3 SV=1 39 347 2.0E-52
sp|Q8Y0K4|MOAA_RALSO Cyclic pyranopterin monophosphate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=moaA PE=3 SV=2 35 336 3.0E-52
sp|Q7NCF5|MOAA_GLOVI Cyclic pyranopterin monophosphate synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=moaA PE=3 SV=1 49 343 3.0E-52
sp|A5UFB4|MOAA_HAEIG Cyclic pyranopterin monophosphate synthase OS=Haemophilus influenzae (strain PittGG) GN=moaA PE=3 SV=1 39 347 4.0E-52
sp|Q97HL8|MOAA_CLOAB Cyclic pyranopterin monophosphate synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=moaA PE=3 SV=1 40 347 4.0E-52
sp|C0Z9B3|MOAA_BREBN Cyclic pyranopterin monophosphate synthase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=moaA PE=3 SV=1 39 337 4.0E-52
sp|A7Z9P0|MOAA_BACMF Cyclic pyranopterin monophosphate synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=moaA PE=3 SV=1 51 336 6.0E-52
sp|A3N054|MOAA_ACTP2 Cyclic pyranopterin monophosphate synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=moaA PE=3 SV=1 39 347 9.0E-52
sp|Q9I3K7|MOAA2_PSEAE Cyclic pyranopterin monophosphate synthase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=moaA2 PE=3 SV=1 39 352 1.0E-51
sp|A0KIL8|MOAA_AERHH Cyclic pyranopterin monophosphate synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=moaA PE=3 SV=1 36 347 1.0E-51
sp|C3LTS1|MOAA_VIBCM Cyclic pyranopterin monophosphate synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=moaA PE=3 SV=1 39 347 2.0E-51
sp|Q9KT81|MOAA_VIBCH Cyclic pyranopterin monophosphate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=moaA PE=3 SV=1 39 347 2.0E-51
sp|A5F2Q5|MOAA_VIBC3 Cyclic pyranopterin monophosphate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=moaA PE=3 SV=1 39 347 2.0E-51
sp|A5UBK4|MOAA_HAEIE Cyclic pyranopterin monophosphate synthase OS=Haemophilus influenzae (strain PittEE) GN=moaA PE=3 SV=1 39 347 2.0E-51
sp|P62589|MOAA3_MYCTO Cyclic pyranopterin monophosphate synthase 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moaA3 PE=3 SV=1 42 339 2.0E-51
sp|P62588|MOAA3_MYCBO Cyclic pyranopterin monophosphate synthase 3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=moaA3 PE=3 SV=1 42 339 2.0E-51
sp|A0LVG0|MOAA_ACIC1 Cyclic pyranopterin monophosphate synthase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=moaA PE=3 SV=1 42 340 2.0E-51
sp|B7VLU4|MOAA_VIBTL Cyclic pyranopterin monophosphate synthase OS=Vibrio tasmaniensis (strain LGP32) GN=moaA PE=3 SV=1 39 347 4.0E-51
sp|Q7N6P6|MOAA_PHOLL Cyclic pyranopterin monophosphate synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=moaA PE=3 SV=1 39 347 4.0E-51
sp|Q49ZI6|MOAA_STAS1 Cyclic pyranopterin monophosphate synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=moaA PE=3 SV=1 39 334 4.0E-51
sp|B3GXC5|MOAA_ACTP7 Cyclic pyranopterin monophosphate synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=moaA PE=3 SV=1 39 347 4.0E-51
sp|B0BNX2|MOAA_ACTPJ Cyclic pyranopterin monophosphate synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=moaA PE=3 SV=1 39 347 4.0E-51
sp|O67929|MOAA_AQUAE Cyclic pyranopterin monophosphate synthase OS=Aquifex aeolicus (strain VF5) GN=moaA PE=3 SV=1 41 315 5.0E-51
sp|Q3V7S1|MOAA_RHOPA Cyclic pyranopterin monophosphate synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=moaA PE=3 SV=1 34 362 5.0E-51
sp|Q7VLN1|MOAA_HAEDU Cyclic pyranopterin monophosphate synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=moaA PE=3 SV=1 35 312 8.0E-51
sp|Q92PB4|MOAA_RHIME Cyclic pyranopterin monophosphate synthase OS=Rhizobium meliloti (strain 1021) GN=moaA PE=3 SV=1 30 362 1.0E-50
sp|Q87MY0|MOAA_VIBPA Cyclic pyranopterin monophosphate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=moaA PE=3 SV=1 39 347 1.0E-50
sp|Q7TX84|MOAA1_MYCBO Cyclic pyranopterin monophosphate synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=moaA1 PE=3 SV=1 42 336 1.0E-50
sp|B3QCQ7|MOAA_RHOPT Cyclic pyranopterin monophosphate synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=moaA PE=3 SV=1 34 362 1.0E-50
sp|P9WJS3|MOAA1_MYCTU Cyclic pyranopterin monophosphate synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moaA1 PE=2 SV=1 42 336 1.0E-50
sp|P9WJS2|MOAA1_MYCTO Cyclic pyranopterin monophosphate synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moaA1 PE=3 SV=1 42 336 1.0E-50
sp|C4LFK3|MOAA_TOLAT Cyclic pyranopterin monophosphate synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=moaA PE=3 SV=1 42 347 2.0E-50
sp|Q98MK6|MOAA_RHILO Cyclic pyranopterin monophosphate synthase OS=Rhizobium loti (strain MAFF303099) GN=moaA PE=3 SV=1 39 362 3.0E-50
sp|B1X0G3|MOAA_CYAA5 Cyclic pyranopterin monophosphate synthase OS=Cyanothece sp. (strain ATCC 51142) GN=moaA PE=3 SV=1 50 328 3.0E-50
sp|A7MJ10|MOAA_CROS8 Cyclic pyranopterin monophosphate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=moaA PE=3 SV=1 39 347 9.0E-50
sp|Q21I62|MOAA_SACD2 Cyclic pyranopterin monophosphate synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=moaA PE=3 SV=1 40 347 1.0E-49
sp|P39757|MOAA_BACSU Cyclic pyranopterin monophosphate synthase OS=Bacillus subtilis (strain 168) GN=moaA PE=3 SV=1 39 336 2.0E-49
sp|Q139F2|MOAA_RHOPS Cyclic pyranopterin monophosphate synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=moaA PE=3 SV=1 42 362 3.0E-49
sp|A6Q5D0|MOAA_NITSB Cyclic pyranopterin monophosphate synthase OS=Nitratiruptor sp. (strain SB155-2) GN=moaA PE=3 SV=1 40 365 3.0E-49
sp|Q30P92|MOAA_SULDN Cyclic pyranopterin monophosphate synthase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=moaA PE=3 SV=1 41 326 3.0E-49
sp|Q9K9W9|MOAA_BACHD Cyclic pyranopterin monophosphate synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=moaA PE=3 SV=1 32 334 4.0E-49
sp|Q89NT2|MOAA_BRADU Cyclic pyranopterin monophosphate synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=moaA PE=3 SV=1 36 362 5.0E-49
sp|A1VXP5|MOAA_CAMJJ Cyclic pyranopterin monophosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=moaA PE=3 SV=1 40 326 5.0E-49
sp|Q9PIW6|MOAA_CAMJE Cyclic pyranopterin monophosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=moaA PE=1 SV=1 40 326 5.0E-49
sp|A8FJX0|MOAA_CAMJ8 Cyclic pyranopterin monophosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=moaA PE=3 SV=1 40 326 5.0E-49
sp|Q7MM75|MOAA_VIBVY Cyclic pyranopterin monophosphate synthase OS=Vibrio vulnificus (strain YJ016) GN=moaA PE=3 SV=2 39 347 6.0E-49
sp|A7H1N9|MOAA_CAMJD Cyclic pyranopterin monophosphate synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=moaA PE=3 SV=1 40 326 1.0E-48
sp|Q5HX04|MOAA_CAMJR Cyclic pyranopterin monophosphate synthase OS=Campylobacter jejuni (strain RM1221) GN=moaA PE=3 SV=1 40 326 1.0E-48
sp|Q8D894|MOAA_VIBVU Cyclic pyranopterin monophosphate synthase OS=Vibrio vulnificus (strain CMCP6) GN=moaA PE=3 SV=2 39 347 1.0E-48
sp|B9KDV3|MOAA_CAMLR Cyclic pyranopterin monophosphate synthase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=moaA PE=3 SV=1 41 325 1.0E-48
sp|Q2NCE3|MOAA_ERYLH Cyclic pyranopterin monophosphate synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=moaA PE=3 SV=1 39 347 2.0E-48
sp|A9MTH7|MOAA_SALPB Cyclic pyranopterin monophosphate synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=moaA PE=3 SV=1 39 347 7.0E-48
sp|P65386|MOAA_SALTY Cyclic pyranopterin monophosphate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=moaA PE=3 SV=1 39 347 8.0E-48
sp|P65387|MOAA_SALTI Cyclic pyranopterin monophosphate synthase OS=Salmonella typhi GN=moaA PE=3 SV=1 39 347 8.0E-48
sp|B4TQU6|MOAA_SALSV Cyclic pyranopterin monophosphate synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=moaA PE=3 SV=1 39 347 8.0E-48
sp|B5BC24|MOAA_SALPK Cyclic pyranopterin monophosphate synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=moaA PE=3 SV=1 39 347 8.0E-48
sp|Q5PG37|MOAA_SALPA Cyclic pyranopterin monophosphate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=moaA PE=3 SV=1 39 347 8.0E-48
sp|B4SZK4|MOAA_SALNS Cyclic pyranopterin monophosphate synthase OS=Salmonella newport (strain SL254) GN=moaA PE=3 SV=1 39 347 8.0E-48
sp|B5F079|MOAA_SALA4 Cyclic pyranopterin monophosphate synthase OS=Salmonella agona (strain SL483) GN=moaA PE=3 SV=1 39 347 8.0E-48
sp|C0PWZ0|MOAA_SALPC Cyclic pyranopterin monophosphate synthase OS=Salmonella paratyphi C (strain RKS4594) GN=moaA PE=3 SV=1 39 347 8.0E-48
sp|A7GWA5|MOAA_CAMC5 Cyclic pyranopterin monophosphate synthase OS=Campylobacter curvus (strain 525.92) GN=moaA PE=3 SV=1 40 326 9.0E-48
sp|B5R769|MOAA_SALG2 Cyclic pyranopterin monophosphate synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=moaA PE=3 SV=1 39 347 1.0E-47
sp|B5QX73|MOAA_SALEP Cyclic pyranopterin monophosphate synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=moaA PE=3 SV=1 39 347 1.0E-47
sp|B5FP68|MOAA_SALDC Cyclic pyranopterin monophosphate synthase OS=Salmonella dublin (strain CT_02021853) GN=moaA PE=3 SV=1 39 347 1.0E-47
sp|C3LA56|MOAA_BACAC Cyclic pyranopterin monophosphate synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=moaA PE=3 SV=1 41 348 2.0E-47
sp|Q8PNH1|MOAA_XANAC Cyclic pyranopterin monophosphate synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=moaA PE=3 SV=1 37 312 2.0E-47
sp|A0RMJ2|MOAA_CAMFF Cyclic pyranopterin monophosphate synthase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=moaA PE=3 SV=1 40 347 2.0E-47
sp|B4TC55|MOAA_SALHS Cyclic pyranopterin monophosphate synthase OS=Salmonella heidelberg (strain SL476) GN=moaA PE=3 SV=1 39 347 2.0E-47
sp|A1B4A2|MOAA_PARDP Cyclic pyranopterin monophosphate synthase OS=Paracoccus denitrificans (strain Pd 1222) GN=moaA PE=3 SV=1 40 347 2.0E-47
sp|A6VPY2|MOAA_ACTSZ Cyclic pyranopterin monophosphate synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=moaA PE=3 SV=1 39 347 2.0E-47
sp|A8ERS0|MOAA_ARCB4 Cyclic pyranopterin monophosphate synthase OS=Arcobacter butzleri (strain RM4018) GN=moaA PE=3 SV=1 41 357 3.0E-47
sp|Q32I50|MOAA_SHIDS Cyclic pyranopterin monophosphate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=moaA PE=3 SV=1 39 347 3.0E-47
sp|A7ZY37|MOAA_ECOHS Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O9:H4 (strain HS) GN=moaA PE=3 SV=1 39 347 3.0E-47
sp|B7NA81|MOAA_ECOLU Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=moaA PE=3 SV=1 39 347 4.0E-47
sp|P30745|MOAA_ECOLI Cyclic pyranopterin monophosphate synthase OS=Escherichia coli (strain K12) GN=moaA PE=1 SV=1 39 347 6.0E-47
sp|B1X7B1|MOAA_ECODH Cyclic pyranopterin monophosphate synthase OS=Escherichia coli (strain K12 / DH10B) GN=moaA PE=3 SV=1 39 347 6.0E-47
sp|C4ZXV3|MOAA_ECOBW Cyclic pyranopterin monophosphate synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=moaA PE=3 SV=1 39 347 6.0E-47
sp|B7LJY1|MOAA_ESCF3 Cyclic pyranopterin monophosphate synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=moaA PE=3 SV=1 39 347 6.0E-47
sp|Q3Z403|MOAA_SHISS Cyclic pyranopterin monophosphate synthase OS=Shigella sonnei (strain Ss046) GN=moaA PE=3 SV=1 39 347 7.0E-47
sp|Q83S40|MOAA_SHIFL Cyclic pyranopterin monophosphate synthase OS=Shigella flexneri GN=moaA PE=3 SV=4 39 347 1.0E-46
sp|A8LIR8|MOAA_DINSH Cyclic pyranopterin monophosphate synthase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=moaA PE=3 SV=1 37 351 1.0E-46
sp|Q12T28|MOAA_SHEDO Cyclic pyranopterin monophosphate synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=moaA PE=3 SV=1 39 348 1.0E-46
sp|Q324B1|MOAA_SHIBS Cyclic pyranopterin monophosphate synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=moaA PE=3 SV=1 39 347 1.0E-46
sp|B1LM72|MOAA_ECOSM Cyclic pyranopterin monophosphate synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=moaA PE=3 SV=1 39 347 1.0E-46
sp|B6I7T6|MOAA_ECOSE Cyclic pyranopterin monophosphate synthase OS=Escherichia coli (strain SE11) GN=moaA PE=3 SV=1 39 347 1.0E-46
sp|P65382|MOAA_ECOL6 Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=moaA PE=3 SV=1 39 347 1.0E-46
sp|B7M753|MOAA_ECO8A Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O8 (strain IAI1) GN=moaA PE=3 SV=1 39 347 1.0E-46
sp|B7MQN5|MOAA_ECO81 Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O81 (strain ED1a) GN=moaA PE=3 SV=1 39 347 1.0E-46
sp|B5YRM0|MOAA_ECO5E Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=moaA PE=3 SV=1 39 347 1.0E-46
sp|P65383|MOAA_ECO57 Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O157:H7 GN=moaA PE=3 SV=1 39 347 1.0E-46
sp|B7LC63|MOAA_ECO55 Cyclic pyranopterin monophosphate synthase OS=Escherichia coli (strain 55989 / EAEC) GN=moaA PE=3 SV=1 39 347 1.0E-46
sp|A7ZJJ0|MOAA_ECO24 Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=moaA PE=3 SV=1 39 347 1.0E-46
sp|Q9CN21|MOAA_PASMU Cyclic pyranopterin monophosphate synthase OS=Pasteurella multocida (strain Pm70) GN=moaA PE=3 SV=1 41 347 1.0E-46
sp|Q6D3C7|MOAA_PECAS Cyclic pyranopterin monophosphate synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=moaA PE=3 SV=1 39 347 2.0E-46
sp|C5B7H2|MOAA_EDWI9 Cyclic pyranopterin monophosphate synthase OS=Edwardsiella ictaluri (strain 93-146) GN=moaA PE=3 SV=1 39 347 2.0E-46
sp|A7ZB87|MOAA_CAMC1 Cyclic pyranopterin monophosphate synthase OS=Campylobacter concisus (strain 13826) GN=moaA PE=3 SV=1 41 336 2.0E-46
sp|B7MGN9|MOAA_ECO45 Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=moaA PE=3 SV=1 39 347 3.0E-46
sp|B7NNL1|MOAA_ECO7I Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=moaA PE=3 SV=1 39 347 3.0E-46
sp|B2TVE9|MOAA_SHIB3 Cyclic pyranopterin monophosphate synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=moaA PE=3 SV=1 39 347 3.0E-46
sp|Q55369|MOAA_SYNY3 Cyclic pyranopterin monophosphate synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=moaA PE=3 SV=1 29 344 4.0E-46
sp|B7ULX8|MOAA_ECO27 Cyclic pyranopterin monophosphate synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=moaA PE=3 SV=1 39 347 4.0E-46
sp|B5XYW6|MOAA_KLEP3 Cyclic pyranopterin monophosphate synthase OS=Klebsiella pneumoniae (strain 342) GN=moaA PE=3 SV=1 39 347 5.0E-46
sp|A6Q6R2|MOAA_SULNB Cyclic pyranopterin monophosphate synthase OS=Sulfurovum sp. (strain NBC37-1) GN=moaA PE=3 SV=1 40 326 1.0E-45
sp|A6T6M5|MOAA_KLEP7 Cyclic pyranopterin monophosphate synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=moaA PE=3 SV=1 39 347 3.0E-45
sp|Q9ZL75|MOAA_HELPJ Cyclic pyranopterin monophosphate synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=moaA PE=3 SV=1 40 365 5.0E-45
sp|P56414|MOAA_HELPY Cyclic pyranopterin monophosphate synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=moaA PE=3 SV=1 40 365 3.0E-44
sp|B6JM01|MOAA_HELP2 Cyclic pyranopterin monophosphate synthase OS=Helicobacter pylori (strain P12) GN=moaA PE=3 SV=1 40 365 3.0E-44
sp|Q1CTA2|MOAA_HELPH Cyclic pyranopterin monophosphate synthase OS=Helicobacter pylori (strain HPAG1) GN=moaA PE=3 SV=1 40 365 2.0E-43
sp|Q8PBX1|MOAA_XANCP Cyclic pyranopterin monophosphate synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=moaA PE=3 SV=1 42 312 2.0E-43
sp|Q4URN0|MOAA_XANC8 Cyclic pyranopterin monophosphate synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=moaA PE=3 SV=1 42 312 2.0E-43
sp|B0RTE0|MOAA_XANCB Cyclic pyranopterin monophosphate synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=moaA PE=3 SV=1 42 312 3.0E-43
sp|Q8U4J5|MOAA_PYRFU Probable cyclic pyranopterin monophosphate synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=moaA PE=3 SV=1 40 344 9.0E-43
sp|O57854|MOAA_PYRHO Probable cyclic pyranopterin monophosphate synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=moaA PE=3 SV=2 40 344 1.0E-42
sp|Q3AVP9|MOAA_SYNS9 Cyclic pyranopterin monophosphate synthase OS=Synechococcus sp. (strain CC9902) GN=moaA PE=3 SV=1 41 338 1.0E-42
sp|Q5JHN5|MOAA_THEKO Probable cyclic pyranopterin monophosphate synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=moaA PE=3 SV=1 42 341 4.0E-42
sp|Q9V2G2|MOAA_PYRAB Probable cyclic pyranopterin monophosphate synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=moaA PE=3 SV=1 40 344 2.0E-40
sp|Q3AGB7|MOAA_SYNSC Cyclic pyranopterin monophosphate synthase OS=Synechococcus sp. (strain CC9605) GN=moaA PE=3 SV=1 40 338 3.0E-40
sp|Q9X5W3|MOAA_RHOCA Cyclic pyranopterin monophosphate synthase OS=Rhodobacter capsulatus GN=moaA PE=3 SV=1 40 348 7.0E-40
sp|Q0W3L5|MOAA_METAR Probable cyclic pyranopterin monophosphate synthase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=moaA PE=3 SV=1 40 340 9.0E-40
sp|O28273|MOAA_ARCFU Probable cyclic pyranopterin monophosphate synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=moaA PE=3 SV=1 42 349 4.0E-39
sp|Q7U3H2|MOAA_SYNPX Cyclic pyranopterin monophosphate synthase OS=Synechococcus sp. (strain WH8102) GN=moaA PE=3 SV=1 40 312 6.0E-38
sp|A8FK41|MOAC_CAMJ8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=moaC PE=3 SV=1 400 580 1.0E-37
sp|Q5HWL3|MOAC_CAMJR Cyclic pyranopterin monophosphate synthase accessory protein OS=Campylobacter jejuni (strain RM1221) GN=moaC PE=3 SV=1 400 580 4.0E-37
sp|A7H1U7|MOAC_CAMJD Cyclic pyranopterin monophosphate synthase accessory protein OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=moaC PE=3 SV=1 400 580 9.0E-37
sp|B9LKK2|MOAC_CHLSY Cyclic pyranopterin monophosphate synthase accessory protein OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=moaC PE=3 SV=1 399 580 1.0E-36
sp|A9WG82|MOAC_CHLAA Cyclic pyranopterin monophosphate synthase accessory protein OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=moaC PE=3 SV=1 399 580 1.0E-36
sp|A8LMJ8|MOAC_DINSH Cyclic pyranopterin monophosphate synthase accessory protein OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=moaC PE=3 SV=1 399 578 2.0E-36
sp|A1VXX6|MOAC_CAMJJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=moaC PE=3 SV=1 400 580 3.0E-36
sp|Q9PIP3|MOAC_CAMJE Cyclic pyranopterin monophosphate synthase accessory protein OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=moaC PE=1 SV=1 400 580 8.0E-36
sp|B2UT33|MOAC_HELPS Cyclic pyranopterin monophosphate synthase accessory protein OS=Helicobacter pylori (strain Shi470) GN=moaC PE=3 SV=1 401 579 2.0E-35
sp|A4WX66|MOAC_RHOS5 Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=moaC PE=3 SV=1 399 578 2.0E-35
sp|P94328|MOAC_BRADU Cyclic pyranopterin monophosphate synthase accessory protein OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=moaC PE=3 SV=2 397 578 3.0E-35
sp|A9B327|MOAC_HERA2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=moaC PE=3 SV=1 401 582 4.0E-35
sp|B8G5X1|MOAC_CHLAD Cyclic pyranopterin monophosphate synthase accessory protein OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=moaC PE=3 SV=1 397 580 4.0E-35
sp|B9KMU9|MOAC_RHOSK Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=moaC PE=3 SV=1 399 578 5.0E-35
sp|Q9ZFA6|MOAC_RHOS4 Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=moaC PE=3 SV=1 399 578 5.0E-35
sp|B8IPA1|MOAC_METNO Cyclic pyranopterin monophosphate synthase accessory protein OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=moaC PE=3 SV=1 401 578 6.0E-35
sp|Q9EYN8|MOAA_SYNPW Cyclic pyranopterin monophosphate synthase OS=Synechococcus sp. (strain WH7803) GN=moaA PE=3 SV=1 41 312 7.0E-35
sp|B5Z7G0|MOAC_HELPG Cyclic pyranopterin monophosphate synthase accessory protein OS=Helicobacter pylori (strain G27) GN=moaC PE=3 SV=1 401 579 7.0E-35
sp|Q1CT72|MOAC_HELPH Cyclic pyranopterin monophosphate synthase accessory protein OS=Helicobacter pylori (strain HPAG1) GN=moaC PE=3 SV=1 401 579 8.0E-35
sp|B6JM29|MOAC_HELP2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Helicobacter pylori (strain P12) GN=moaC PE=3 SV=1 401 579 9.0E-35
sp|Q8TUG2|MOAA_METAC Probable cyclic pyranopterin monophosphate synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=moaA PE=3 SV=1 40 344 1.0E-34
sp|A7HXZ9|MOAC_PARL1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=moaC PE=3 SV=1 397 578 1.0E-34
sp|C3MCF1|MOAC_RHISN Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhizobium sp. (strain NGR234) GN=moaC PE=3 SV=1 397 580 2.0E-34
sp|Q48260|MOAC_HELPY Cyclic pyranopterin monophosphate synthase accessory protein OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=moaC PE=3 SV=2 401 579 3.0E-34
sp|Q8CNE0|MOAC_STAES Cyclic pyranopterin monophosphate synthase accessory protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=moaC PE=3 SV=1 399 580 3.0E-34
sp|Q5HLX5|MOAC_STAEQ Cyclic pyranopterin monophosphate synthase accessory protein OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=moaC PE=3 SV=1 399 580 3.0E-34
sp|Q21R65|MOAC_RHOFT Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=moaC PE=3 SV=1 399 578 3.0E-34
sp|Q3SL94|MOAC_THIDA Cyclic pyranopterin monophosphate synthase accessory protein OS=Thiobacillus denitrificans (strain ATCC 25259) GN=moaC PE=3 SV=1 399 578 3.0E-34
sp|A3PHK6|MOAC_RHOS1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=moaC PE=3 SV=1 399 578 4.0E-34
sp|A7INK0|MOAC_XANP2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=moaC PE=3 SV=1 399 578 6.0E-34
sp|B9KEM3|MOAC_CAMLR Cyclic pyranopterin monophosphate synthase accessory protein OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=moaC PE=3 SV=1 401 580 7.0E-34
sp|Q7VK40|MOAC_HELHP Cyclic pyranopterin monophosphate synthase accessory protein OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=moaC PE=3 SV=1 400 580 7.0E-34
sp|Q8UER6|MOAC_AGRFC Cyclic pyranopterin monophosphate synthase accessory protein OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=moaC PE=3 SV=1 396 580 7.0E-34
sp|B6IQ15|MOAC_RHOCS Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=moaC PE=3 SV=1 396 578 9.0E-34
sp|Q8PX29|MOAA_METMA Probable cyclic pyranopterin monophosphate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=moaA PE=3 SV=1 40 312 1.0E-33
sp|B9E9E3|MOAC_MACCJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Macrococcus caseolyticus (strain JCSC5402) GN=moaC PE=3 SV=1 399 580 1.0E-33
sp|Q3M7N0|MOAC_ANAVT Cyclic pyranopterin monophosphate synthase accessory protein OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=moaC PE=3 SV=1 397 578 2.0E-33
sp|Q971H1|MOAA_SULTO Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=moaA PE=3 SV=1 41 339 2.0E-33
sp|C5D4E6|MOAC_GEOSW Cyclic pyranopterin monophosphate synthase accessory protein OS=Geobacillus sp. (strain WCH70) GN=moaC PE=3 SV=1 399 580 2.0E-33
sp|B0T229|MOAC_CAUSK Cyclic pyranopterin monophosphate synthase accessory protein OS=Caulobacter sp. (strain K31) GN=moaC PE=3 SV=1 399 578 3.0E-33
sp|Q39056|CNX3_ARATH Cyclic pyranopterin monophosphate synthase accessory protein, mitochondrial OS=Arabidopsis thaliana GN=CNX3 PE=1 SV=1 375 581 3.0E-33
sp|Q3ADX7|MOAC_CARHZ Cyclic pyranopterin monophosphate synthase accessory protein OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=moaC PE=3 SV=1 400 580 4.0E-33
sp|A4IJU6|MOAC_GEOTN Cyclic pyranopterin monophosphate synthase accessory protein OS=Geobacillus thermodenitrificans (strain NG80-2) GN=moaC PE=3 SV=1 399 580 4.0E-33
sp|B2IKL8|MOAC_BEII9 Cyclic pyranopterin monophosphate synthase accessory protein OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=moaC PE=3 SV=1 399 580 6.0E-33
sp|A6U9C6|MOAC_SINMW Cyclic pyranopterin monophosphate synthase accessory protein OS=Sinorhizobium medicae (strain WSM419) GN=moaC PE=3 SV=1 397 580 6.0E-33
sp|Q9ZL46|MOAC_HELPJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=moaC PE=3 SV=1 401 579 8.0E-33
sp|A6UX30|MOAA_META3 Probable cyclic pyranopterin monophosphate synthase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=moaA PE=3 SV=1 42 323 8.0E-33
sp|Q979T0|MOAA_THEVO Probable cyclic pyranopterin monophosphate synthase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=moaA PE=3 SV=1 42 344 8.0E-33
sp|Q92PR8|MOAC_RHIME Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhizobium meliloti (strain 1021) GN=moaC PE=3 SV=1 397 580 9.0E-33
sp|A8I831|MOAC_AZOC5 Cyclic pyranopterin monophosphate synthase accessory protein OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=moaC PE=3 SV=1 399 578 1.0E-32
sp|Q1H4W7|MOAC_METFK Cyclic pyranopterin monophosphate synthase accessory protein OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=moaC PE=3 SV=1 399 578 1.0E-32
sp|Q111C2|MOAC_TRIEI Cyclic pyranopterin monophosphate synthase accessory protein OS=Trichodesmium erythraeum (strain IMS101) GN=moaC PE=3 SV=1 401 578 2.0E-32
sp|B0U7Z3|MOAC_METS4 Cyclic pyranopterin monophosphate synthase accessory protein OS=Methylobacterium sp. (strain 4-46) GN=moaC PE=3 SV=1 399 579 2.0E-32
sp|A5UQR2|MOAC_ROSS1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Roseiflexus sp. (strain RS-1) GN=moaC PE=3 SV=1 399 578 2.0E-32
sp|Q5L3F4|MOAC_GEOKA Cyclic pyranopterin monophosphate synthase accessory protein OS=Geobacillus kaustophilus (strain HTA426) GN=moaC PE=1 SV=1 399 580 2.0E-32
sp|A5VQR6|MOAC_BRUO2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=moaC PE=3 SV=1 398 579 2.0E-32
sp|Q57CZ7|MOAC_BRUAB Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella abortus biovar 1 (strain 9-941) GN=moaC PE=3 SV=1 398 579 2.0E-32
sp|Q2YRR3|MOAC_BRUA2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella abortus (strain 2308) GN=moaC PE=3 SV=1 398 579 2.0E-32
sp|B2S5Z2|MOAC_BRUA1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella abortus (strain S19) GN=moaC PE=3 SV=1 398 579 2.0E-32
sp|Q8YHF9|MOAC_BRUME Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=moaC PE=3 SV=1 398 579 2.0E-32
sp|C0RJB2|MOAC_BRUMB Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=moaC PE=3 SV=1 398 579 2.0E-32
sp|A7GTZ9|MOAC_BACCN Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=moaC PE=3 SV=1 399 580 3.0E-32
sp|Q2RQI5|MOAC_RHORT Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=moaC PE=3 SV=1 396 579 3.0E-32
sp|Q0VQ23|MOAC_ALCBS Cyclic pyranopterin monophosphate synthase accessory protein OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=moaC PE=3 SV=1 400 580 3.0E-32
sp|O27593|MOAA_METTH Probable cyclic pyranopterin monophosphate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=moaA PE=3 SV=2 42 312 3.0E-32
sp|Q30NY7|MOAC_SULDN Cyclic pyranopterin monophosphate synthase accessory protein OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=moaC PE=3 SV=1 400 580 3.0E-32
sp|A8EX06|MOAC_ARCB4 Cyclic pyranopterin monophosphate synthase accessory protein OS=Arcobacter butzleri (strain RM4018) GN=moaC PE=3 SV=1 400 580 5.0E-32
sp|Q980F0|MOAA_SULSO Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=moaA PE=3 SV=1 41 330 5.0E-32
sp|A9AFU0|MOAC_BURM1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=moaC PE=3 SV=1 399 576 6.0E-32
sp|C5CRA3|MOAC_VARPS Cyclic pyranopterin monophosphate synthase accessory protein OS=Variovorax paradoxus (strain S110) GN=moaC PE=3 SV=1 399 578 7.0E-32
sp|P9WJR5|MOAC3_MYCTU Cyclic pyranopterin monophosphate synthase accessory protein 3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moaC3 PE=3 SV=1 401 580 8.0E-32
sp|P9WJR4|MOAC3_MYCTO Cyclic pyranopterin monophosphate synthase accessory protein 3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moaC3 PE=3 SV=1 401 580 8.0E-32
sp|P65393|MOAC3_MYCBO Cyclic pyranopterin monophosphate synthase accessory protein 3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=moaC3 PE=3 SV=1 401 580 8.0E-32
sp|A6X0K9|MOAC_OCHA4 Cyclic pyranopterin monophosphate synthase accessory protein OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=moaC PE=3 SV=1 399 578 1.0E-31
sp|Q8YRR1|MOAC_NOSS1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=moaC PE=3 SV=1 397 578 1.0E-31
sp|B2UGE9|MOAC_RALPJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Ralstonia pickettii (strain 12J) GN=moaC PE=3 SV=1 399 578 1.0E-31
sp|Q603S0|MOAC_METCA Cyclic pyranopterin monophosphate synthase accessory protein OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=moaC PE=3 SV=1 400 580 1.0E-31
sp|C3MXF3|MOAA_SULIM Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=moaA PE=3 SV=1 41 330 2.0E-31
sp|C4KIH7|MOAA_SULIK Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=moaA PE=3 SV=1 41 330 2.0E-31
sp|C3MZ99|MOAA_SULIA Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus islandicus (strain M.16.27) GN=moaA PE=3 SV=1 41 330 2.0E-31
sp|Q28R69|MOAC_JANSC Cyclic pyranopterin monophosphate synthase accessory protein OS=Jannaschia sp. (strain CCS1) GN=moaC PE=3 SV=1 399 578 2.0E-31
sp|A0L7R3|MOAC_MAGMM Cyclic pyranopterin monophosphate synthase accessory protein OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=moaC PE=3 SV=1 401 580 3.0E-31
sp|B1JY03|MOAC_BURCC Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia cenocepacia (strain MC0-3) GN=moaC PE=3 SV=1 399 576 5.0E-31
sp|Q8G0F3|MOAC_BRUSU Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella suis biovar 1 (strain 1330) GN=moaC PE=3 SV=1 398 579 5.0E-31
sp|B0CGU0|MOAC_BRUSI Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=moaC PE=3 SV=1 398 579 5.0E-31
sp|A9M5F5|MOAC_BRUC2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=moaC PE=3 SV=1 398 579 5.0E-31
sp|A7MJ08|MOAC_CROS8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=moaC PE=3 SV=1 399 578 5.0E-31
sp|C3NGB5|MOAA_SULIN Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=moaA PE=3 SV=1 41 330 5.0E-31
sp|B0K0F7|MOAC_THEPX Cyclic pyranopterin monophosphate synthase accessory protein OS=Thermoanaerobacter sp. (strain X514) GN=moaC PE=3 SV=1 401 580 6.0E-31
sp|A5UBK5|MOAC_HAEIE Cyclic pyranopterin monophosphate synthase accessory protein OS=Haemophilus influenzae (strain PittEE) GN=moaC PE=3 SV=1 401 578 7.0E-31
sp|Q58234|MOAA_METJA Probable cyclic pyranopterin monophosphate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=moaA PE=3 SV=1 42 323 8.0E-31
sp|A6VPY1|MOAC_ACTSZ Cyclic pyranopterin monophosphate synthase accessory protein OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=moaC PE=3 SV=1 399 578 9.0E-31
sp|B1HQT3|MOAC_LYSSC Cyclic pyranopterin monophosphate synthase accessory protein OS=Lysinibacillus sphaericus (strain C3-41) GN=moaC PE=3 SV=1 399 579 9.0E-31
sp|B8FMV2|MOAC_DESAA Cyclic pyranopterin monophosphate synthase accessory protein OS=Desulfatibacillum alkenivorans (strain AK-01) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|C3N7B9|MOAA_SULIY Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=moaA PE=3 SV=1 41 330 1.0E-30
sp|C3MR64|MOAA_SULIL Probable cyclic pyranopterin monophosphate synthase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=moaA PE=3 SV=1 41 330 1.0E-30
sp|B1VTN7|MOAC_STRGG Cyclic pyranopterin monophosphate synthase accessory protein OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=moaC PE=3 SV=1 389 580 1.0E-30
sp|C3LTS3|MOAC_VIBCM Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio cholerae serotype O1 (strain M66-2) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|Q9KT79|MOAC_VIBCH Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|A5F2Q7|MOAC_VIBC3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=moaC PE=3 SV=1 399 578 1.0E-30
sp|B0K8Q5|MOAC_THEP3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=moaC PE=3 SV=1 401 580 1.0E-30
sp|A0KA61|MOAC_BURCH Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia cenocepacia (strain HI2424) GN=moaC PE=3 SV=1 399 576 1.0E-30
sp|Q1BTX7|MOAC_BURCA Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia cenocepacia (strain AU 1054) GN=moaC PE=3 SV=1 399 576 1.0E-30
sp|B2JDC4|MOAC_BURP8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=moaC PE=3 SV=1 400 576 1.0E-30
sp|Q8Y1X7|MOAC_RALSO Cyclic pyranopterin monophosphate synthase accessory protein OS=Ralstonia solanacearum (strain GMI1000) GN=moaC PE=3 SV=1 401 578 1.0E-30
sp|B1YVX4|MOAC_BURA4 Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia ambifaria (strain MC40-6) GN=moaC PE=3 SV=1 399 576 1.0E-30
sp|B0TI15|MOAC_HELMI Cyclic pyranopterin monophosphate synthase accessory protein OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=moaC PE=3 SV=1 401 580 1.0E-30
sp|P45310|MOAC_HAEIN Cyclic pyranopterin monophosphate synthase accessory protein OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=moaC PE=3 SV=1 401 578 1.0E-30
sp|A5FXW0|MOAC_ACICJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Acidiphilium cryptum (strain JF-5) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|A1SWP5|MOAC_PSYIN Cyclic pyranopterin monophosphate synthase accessory protein OS=Psychromonas ingrahamii (strain 37) GN=moaC PE=3 SV=1 401 579 2.0E-30
sp|A6US67|MOAA_METVS Probable cyclic pyranopterin monophosphate synthase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=moaA PE=3 SV=1 42 312 2.0E-30
sp|Q0AVU7|MOAC_SYNWW Cyclic pyranopterin monophosphate synthase accessory protein OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=moaC PE=3 SV=1 401 580 2.0E-30
sp|B5XYW4|MOAC_KLEP3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Klebsiella pneumoniae (strain 342) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|Q7MM73|MOAC_VIBVY Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio vulnificus (strain YJ016) GN=moaC PE=3 SV=1 399 578 2.0E-30
sp|A5UFB3|MOAC_HAEIG Cyclic pyranopterin monophosphate synthase accessory protein OS=Haemophilus influenzae (strain PittGG) GN=moaC PE=3 SV=1 401 578 2.0E-30
sp|B0BNX3|MOAC_ACTPJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=moaC PE=3 SV=1 399 579 3.0E-30
sp|B3GXC6|MOAC_ACTP7 Cyclic pyranopterin monophosphate synthase accessory protein OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=moaC PE=3 SV=1 399 579 3.0E-30
sp|A3N055|MOAC_ACTP2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=moaC PE=3 SV=1 399 579 3.0E-30
sp|B8GPA2|MOAC_THISH Cyclic pyranopterin monophosphate synthase accessory protein OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=moaC PE=3 SV=1 399 578 3.0E-30
sp|B4ESV1|MOAC_PROMH Cyclic pyranopterin monophosphate synthase accessory protein OS=Proteus mirabilis (strain HI4320) GN=moaC PE=3 SV=1 399 578 3.0E-30
sp|Q97HL9|MOAC_CLOAB Cyclic pyranopterin monophosphate synthase accessory protein OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=moaC PE=3 SV=1 401 581 3.0E-30
sp|Q65TT1|MOAC_MANSM Cyclic pyranopterin monophosphate synthase accessory protein OS=Mannheimia succiniciproducens (strain MBEL55E) GN=moaC PE=3 SV=1 399 578 3.0E-30
sp|A7MVD3|MOAC_VIBCB Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=moaC PE=3 SV=1 399 578 3.0E-30
sp|Q4L8D8|MOAC_STAHJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Staphylococcus haemolyticus (strain JCSC1435) GN=moaC PE=3 SV=1 399 580 3.0E-30
sp|A4JHJ1|MOAC_BURVG Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=moaC PE=3 SV=1 399 579 3.0E-30
sp|Q87MY2|MOAC_VIBPA Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=moaC PE=3 SV=1 399 578 4.0E-30
sp|Q9AC52|MOAC_CAUCR Cyclic pyranopterin monophosphate synthase accessory protein OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=moaC PE=3 SV=2 399 578 4.0E-30
sp|B8GWX1|MOAC_CAUCN Cyclic pyranopterin monophosphate synthase accessory protein OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=moaC PE=3 SV=1 399 578 4.0E-30
sp|A6T6M7|MOAC_KLEP7 Cyclic pyranopterin monophosphate synthase accessory protein OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=moaC PE=3 SV=1 399 578 4.0E-30
sp|B5FCP1|MOAC_VIBFM Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio fischeri (strain MJ11) GN=moaC PE=3 SV=1 399 578 4.0E-30
sp|Q5E6B0|MOAC_VIBF1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=moaC PE=3 SV=1 399 578 4.0E-30
sp|Q8D896|MOAC_VIBVU Cyclic pyranopterin monophosphate synthase accessory protein OS=Vibrio vulnificus (strain CMCP6) GN=moaC PE=3 SV=1 399 578 4.0E-30
sp|Q0BC82|MOAC_BURCM Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=moaC PE=3 SV=1 399 576 5.0E-30
sp|A4W8C6|MOAC_ENT38 Cyclic pyranopterin monophosphate synthase accessory protein OS=Enterobacter sp. (strain 638) GN=moaC PE=3 SV=1 399 578 5.0E-30
sp|C0QKG6|MOAC_DESAH Cyclic pyranopterin monophosphate synthase accessory protein OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=moaC PE=3 SV=1 399 578 5.0E-30
sp|Q0KE68|MOAC_CUPNH Cyclic pyranopterin monophosphate synthase accessory protein OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=moaC PE=3 SV=1 399 576 5.0E-30
sp|Q4QJS0|MOAC_HAEI8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Haemophilus influenzae (strain 86-028NP) GN=moaC PE=3 SV=1 399 578 6.0E-30
sp|B9L0K8|MOAC_THERP Cyclic pyranopterin monophosphate synthase accessory protein OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=moaC PE=3 SV=1 399 580 6.0E-30
sp|B2AHC7|MOAC_CUPTR Cyclic pyranopterin monophosphate synthase accessory protein OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=moaC PE=3 SV=1 399 576 7.0E-30
sp|A6Q6C1|MOAC_SULNB Cyclic pyranopterin monophosphate synthase accessory protein OS=Sulfurovum sp. (strain NBC37-1) GN=moaC PE=3 SV=1 401 580 7.0E-30
sp|Q93KD0|MOAC_EUBAC Cyclic pyranopterin monophosphate synthase accessory protein OS=Eubacterium acidaminophilum GN=moaC PE=3 SV=2 400 580 7.0E-30
sp|Q98ME2|MOAC_RHILO Cyclic pyranopterin monophosphate synthase accessory protein OS=Rhizobium loti (strain MAFF303099) GN=moaC PE=3 SV=1 399 578 7.0E-30
sp|A9MIU5|MOAC_SALAR Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=moaC PE=3 SV=1 399 578 7.0E-30
sp|Q3AVP2|MOAC_SYNS9 Cyclic pyranopterin monophosphate synthase accessory protein OS=Synechococcus sp. (strain CC9902) GN=moaC PE=3 SV=1 397 580 7.0E-30
sp|A9BQ97|MOAC_DELAS Cyclic pyranopterin monophosphate synthase accessory protein OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=moaC PE=3 SV=1 399 575 7.0E-30
sp|A7NQR0|MOAC_ROSCS Cyclic pyranopterin monophosphate synthase accessory protein OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=moaC PE=3 SV=1 399 576 8.0E-30
sp|B5R771|MOAC_SALG2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=moaC PE=3 SV=1 399 578 8.0E-30
sp|B5QX75|MOAC_SALEP Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella enteritidis PT4 (strain P125109) GN=moaC PE=3 SV=1 399 578 8.0E-30
sp|B5FP70|MOAC_SALDC Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella dublin (strain CT_02021853) GN=moaC PE=3 SV=1 399 578 8.0E-30
sp|A8AJ02|MOAC_CITK8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=moaC PE=3 SV=1 399 578 8.0E-30
sp|Q49ZJ2|MOAC_STAS1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=moaC PE=3 SV=1 399 580 9.0E-30
sp|Q13UI4|MOAC_BURXL Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia xenovorans (strain LB400) GN=moaC PE=3 SV=1 400 576 1.0E-29
sp|B8FNT2|MOAC_DESHD Cyclic pyranopterin monophosphate synthase accessory protein OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=moaC PE=3 SV=1 400 580 1.0E-29
sp|Q6HCF7|MOAC_BACHK Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=moaC PE=3 SV=1 399 580 1.0E-29
sp|Q8ZQQ1|MOAC_SALTY Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=moaC PE=3 SV=3 399 578 1.0E-29
sp|B4TQU8|MOAC_SALSV Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella schwarzengrund (strain CVM19633) GN=moaC PE=3 SV=1 399 578 1.0E-29
sp|B5BC22|MOAC_SALPK Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella paratyphi A (strain AKU_12601) GN=moaC PE=3 SV=1 399 578 1.0E-29
sp|C0PWZ2|MOAC_SALPC Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella paratyphi C (strain RKS4594) GN=moaC PE=3 SV=1 399 578 1.0E-29
sp|A9MTH5|MOAC_SALPB Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=moaC PE=3 SV=1 399 578 1.0E-29
sp|Q5PG39|MOAC_SALPA Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=moaC PE=3 SV=1 399 578 1.0E-29
sp|B4SZK6|MOAC_SALNS Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella newport (strain SL254) GN=moaC PE=3 SV=1 399 578 1.0E-29
sp|B4TC57|MOAC_SALHS Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella heidelberg (strain SL476) GN=moaC PE=3 SV=1 399 578 1.0E-29
sp|Q57RF3|MOAC_SALCH Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella choleraesuis (strain SC-B67) GN=moaC PE=3 SV=1 399 578 1.0E-29
sp|B5F081|MOAC_SALA4 Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella agona (strain SL483) GN=moaC PE=3 SV=1 399 578 1.0E-29
sp|Q475L1|MOAC_CUPPJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=moaC PE=3 SV=1 399 578 2.0E-29
sp|Q2NUJ1|MOAC_SODGM Cyclic pyranopterin monophosphate synthase accessory protein OS=Sodalis glossinidius (strain morsitans) GN=moaC PE=3 SV=1 399 579 2.0E-29
sp|B2V3T7|MOAC_CLOBA Cyclic pyranopterin monophosphate synthase accessory protein OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=moaC PE=3 SV=1 399 578 2.0E-29
sp|A7ZY39|MOAC_ECOHS Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O9:H4 (strain HS) GN=moaC PE=3 SV=1 399 578 2.0E-29
sp|Q50746|MOAA_METTM Probable cyclic pyranopterin monophosphate synthase OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=moaA PE=3 SV=2 39 312 2.0E-29
sp|Q816U4|MOAC_BACCR Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=moaC PE=3 SV=1 399 580 2.0E-29
sp|B7H782|MOAC_BACC4 Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain B4264) GN=moaC PE=3 SV=1 399 580 2.0E-29
sp|B7IKZ0|MOAC_BACC2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain G9842) GN=moaC PE=3 SV=1 399 580 2.0E-29
sp|Q7WB92|MOAC_BORPA Cyclic pyranopterin monophosphate synthase accessory protein OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=moaC PE=3 SV=1 396 578 2.0E-29
sp|B4EBZ2|MOAC_BURCJ Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=moaC PE=3 SV=1 399 576 2.0E-29
sp|Q39DA3|MOAC_BURL3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=moaC PE=3 SV=1 399 576 2.0E-29
sp|B9J1C6|MOAC_BACCQ Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain Q1) GN=moaC PE=3 SV=1 399 580 3.0E-29
sp|B7HSR1|MOAC_BACC7 Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain AH187) GN=moaC PE=3 SV=1 399 580 3.0E-29
sp|Q72Z05|MOAC_BACC1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=moaC PE=3 SV=1 399 580 3.0E-29
sp|B2VBW5|MOAC_ERWT9 Cyclic pyranopterin monophosphate synthase accessory protein OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=moaC PE=3 SV=1 399 581 3.0E-29
sp|A1AWX5|MOAC_RUTMC Cyclic pyranopterin monophosphate synthase accessory protein OS=Ruthia magnifica subsp. Calyptogena magnifica GN=moaC PE=3 SV=1 400 578 3.0E-29
sp|Q632W7|MOAC_BACCZ Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain ZK / E33L) GN=moaC PE=3 SV=1 399 580 3.0E-29
sp|C1EVZ1|MOAC_BACC3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain 03BB102) GN=moaC PE=3 SV=1 399 580 3.0E-29
sp|B7JSY7|MOAC_BACC0 Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus cereus (strain AH820) GN=moaC PE=3 SV=1 399 580 3.0E-29
sp|Q81KM1|MOAC_BACAN Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus anthracis GN=moaC PE=3 SV=1 399 580 3.0E-29
sp|A0RJV9|MOAC_BACAH Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus thuringiensis (strain Al Hakam) GN=moaC PE=3 SV=1 399 580 3.0E-29
sp|C3LA30|MOAC_BACAC Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=moaC PE=3 SV=1 399 580 3.0E-29
sp|C3PBI3|MOAC_BACAA Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus anthracis (strain A0248) GN=moaC PE=3 SV=1 399 580 3.0E-29
sp|P0A741|MOAC_SHIFL Cyclic pyranopterin monophosphate synthase accessory protein OS=Shigella flexneri GN=moaC PE=3 SV=2 399 578 3.0E-29
sp|Q0T6H7|MOAC_SHIF8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Shigella flexneri serotype 5b (strain 8401) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|Q32I52|MOAC_SHIDS Cyclic pyranopterin monophosphate synthase accessory protein OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|Q324A9|MOAC_SHIBS Cyclic pyranopterin monophosphate synthase accessory protein OS=Shigella boydii serotype 4 (strain Sb227) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|B2TVE7|MOAC_SHIB3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|B7LJX9|MOAC_ESCF3 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|Q1REE5|MOAC_ECOUT Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain UTI89 / UPEC) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|B1LM74|MOAC_ECOSM Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|B6I7T8|MOAC_ECOSE Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain SE11) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|B7NA83|MOAC_ECOLU Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|P0A738|MOAC_ECOLI Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain K12) GN=moaC PE=1 SV=2 399 578 3.0E-29
sp|B1IXI5|MOAC_ECOLC Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|P0A739|MOAC_ECOL6 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=moaC PE=3 SV=2 399 578 3.0E-29
sp|Q0TJR5|MOAC_ECOL5 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|A1A925|MOAC_ECOK1 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O1:K1 / APEC GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|B1X7B3|MOAC_ECODH Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain K12 / DH10B) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|C4ZXV5|MOAC_ECOBW Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|B7M755|MOAC_ECO8A Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O8 (strain IAI1) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|B7MQN7|MOAC_ECO81 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O81 (strain ED1a) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|B7NNL3|MOAC_ECO7I Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|B5YRM2|MOAC_ECO5E Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|P0A740|MOAC_ECO57 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O157:H7 GN=moaC PE=3 SV=2 399 578 3.0E-29
sp|B7LC65|MOAC_ECO55 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli (strain 55989 / EAEC) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|B7MGP1|MOAC_ECO45 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|B7ULY0|MOAC_ECO27 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|A7ZJJ2|MOAC_ECO24 Cyclic pyranopterin monophosphate synthase accessory protein OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|A6VJM2|MOAA_METM7 Probable cyclic pyranopterin monophosphate synthase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=moaA PE=3 SV=1 42 328 3.0E-29
sp|B6EGI3|MOAC_ALISL Cyclic pyranopterin monophosphate synthase accessory protein OS=Aliivibrio salmonicida (strain LFI1238) GN=moaC PE=3 SV=1 399 578 3.0E-29
sp|Q0HQ78|MOAC_SHESR Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella sp. (strain MR-7) GN=moaC PE=3 SV=1 401 578 4.0E-29
sp|Q0HNL3|MOAC_SHESM Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella sp. (strain MR-4) GN=moaC PE=3 SV=1 401 578 4.0E-29
sp|A0KRU9|MOAC_SHESA Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella sp. (strain ANA-3) GN=moaC PE=3 SV=1 401 578 4.0E-29
sp|Q8E942|MOAC_SHEON Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella oneidensis (strain MR-1) GN=moaC PE=3 SV=1 401 578 4.0E-29
sp|Q6LT40|MOAC_PHOPR Cyclic pyranopterin monophosphate synthase accessory protein OS=Photobacterium profundum GN=moaC PE=3 SV=1 399 578 4.0E-29
sp|Q82H75|MOAC_STRAW Cyclic pyranopterin monophosphate synthase accessory protein OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=moaC PE=3 SV=1 400 580 4.0E-29
sp|Q1LR54|MOAC_CUPMC Cyclic pyranopterin monophosphate synthase accessory protein OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=moaC PE=3 SV=1 399 576 4.0E-29
sp|A0AHF9|MOAC_LISW6 Cyclic pyranopterin monophosphate synthase accessory protein OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=moaC PE=3 SV=1 401 578 4.0E-29
sp|Q9CN22|MOAC_PASMU Cyclic pyranopterin monophosphate synthase accessory protein OS=Pasteurella multocida (strain Pm70) GN=moaC PE=3 SV=1 399 578 4.0E-29
sp|Q2G6Q7|MOAC_NOVAD Cyclic pyranopterin monophosphate synthase accessory protein OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=moaC PE=3 SV=1 399 578 4.0E-29
sp|B2THM0|MOAC_CLOBB Cyclic pyranopterin monophosphate synthase accessory protein OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=moaC PE=3 SV=1 399 578 4.0E-29
sp|Q9RKA8|MOAC_STRCO Cyclic pyranopterin monophosphate synthase accessory protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=moaC PE=3 SV=1 389 580 5.0E-29
sp|Q8Z887|MOAC_SALTI Cyclic pyranopterin monophosphate synthase accessory protein OS=Salmonella typhi GN=moaC PE=3 SV=3 399 578 5.0E-29
sp|A1REK0|MOAC_SHESW Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella sp. (strain W3-18-1) GN=moaC PE=3 SV=1 401 578 7.0E-29
sp|A4Y2D9|MOAC_SHEPC Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=moaC PE=3 SV=1 401 578 7.0E-29
sp|A6WI10|MOAC_SHEB8 Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella baltica (strain OS185) GN=moaC PE=3 SV=1 401 578 7.0E-29
sp|A3CZA5|MOAC_SHEB5 Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=moaC PE=3 SV=1 401 578 7.0E-29
sp|A9A661|MOAA_METM6 Probable cyclic pyranopterin monophosphate synthase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=moaA PE=3 SV=1 42 326 7.0E-29
sp|Q18G49|MOAA_HALWD Probable cyclic pyranopterin monophosphate synthase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=moaA PE=3 SV=1 42 311 7.0E-29
sp|Q721C0|MOAC_LISMF Cyclic pyranopterin monophosphate synthase accessory protein OS=Listeria monocytogenes serotype 4b (strain F2365) GN=moaC PE=3 SV=1 401 578 7.0E-29
sp|C1L1W7|MOAC_LISMC Cyclic pyranopterin monophosphate synthase accessory protein OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=moaC PE=3 SV=1 401 578 7.0E-29
sp|B1J176|MOAC_PSEPW Cyclic pyranopterin monophosphate synthase accessory protein OS=Pseudomonas putida (strain W619) GN=moaC PE=3 SV=1 401 578 7.0E-29
sp|A9KX72|MOAC_SHEB9 Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella baltica (strain OS195) GN=moaC PE=3 SV=1 401 578 8.0E-29
sp|B8E478|MOAC_SHEB2 Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella baltica (strain OS223) GN=moaC PE=3 SV=1 401 578 8.0E-29
sp|B8DCG2|MOAC_LISMH Cyclic pyranopterin monophosphate synthase accessory protein OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=moaC PE=3 SV=1 401 578 8.0E-29
sp|Q88WW9|MOAC_LACPL Cyclic pyranopterin monophosphate synthase accessory protein OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=moaC PE=3 SV=1 400 578 8.0E-29
sp|Q92CY3|MOAC_LISIN Cyclic pyranopterin monophosphate synthase accessory protein OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=moaC PE=3 SV=1 401 578 8.0E-29
sp|A8G1M9|MOAC_SHESH Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella sediminis (strain HAW-EB3) GN=moaC PE=3 SV=1 398 578 9.0E-29
sp|A8GBD6|MOAC_SERP5 Cyclic pyranopterin monophosphate synthase accessory protein OS=Serratia proteamaculans (strain 568) GN=moaC PE=3 SV=1 399 578 9.0E-29
sp|Q3Z401|MOAC_SHISS Cyclic pyranopterin monophosphate synthase accessory protein OS=Shigella sonnei (strain Ss046) GN=moaC PE=3 SV=1 399 578 1.0E-28
sp|C3KEA5|MOAC_PSEFS Cyclic pyranopterin monophosphate synthase accessory protein OS=Pseudomonas fluorescens (strain SBW25) GN=moaC PE=3 SV=1 401 578 1.0E-28
sp|Q2NA95|MOAC_ERYLH Cyclic pyranopterin monophosphate synthase accessory protein OS=Erythrobacter litoralis (strain HTCC2594) GN=moaC PE=3 SV=1 399 576 1.0E-28
sp|Q6LZQ3|MOAA_METMP Probable cyclic pyranopterin monophosphate synthase OS=Methanococcus maripaludis (strain S2 / LL) GN=moaA PE=3 SV=1 42 338 1.0E-28
sp|B1KP09|MOAC_SHEWM Cyclic pyranopterin monophosphate synthase accessory protein OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=moaC PE=3 SV=1 398 578 1.0E-28
sp|Q7VVF8|MOAC_BORPE Cyclic pyranopterin monophosphate synthase accessory protein OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=moaC PE=3 SV=1 396 578 1.0E-28
sp|Q7WMR0|MOAC_BORBR Cyclic pyranopterin monophosphate synthase accessory protein OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=moaC PE=3 SV=1 396 578 1.0E-28
sp|A4SZX3|MOAC_POLSQ Cyclic pyranopterin monophosphate synthase accessory protein OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=moaC PE=3 SV=1 399 578 1.0E-28
sp|B2SYE3|MOAC_BURPP Cyclic pyranopterin monophosphate synthase accessory protein OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=moaC PE=3 SV=1 400 578 2.0E-28
sp|Q8Y871|MOAC_LISMO Cyclic pyranopterin monophosphate synthase accessory protein OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=moaC PE=3 SV=1 401 578 2.0E-28
sp|A7Z200|MOAC_BACMF Cyclic pyranopterin monophosphate synthase accessory protein OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=moaC PE=3 SV=1 401 580 2.0E-28
[Show less]

GO

GO Term Description Terminal node
GO:0006777 Mo-molybdopterin cofactor biosynthetic process Yes
GO:0051539 4 iron, 4 sulfur cluster binding Yes
GO:0019008 molybdopterin synthase complex Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0003824 catalytic activity Yes
GO:0005488 binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0005575 cellular_component No
GO:0006796 phosphate-containing compound metabolic process No
GO:0051189 prosthetic group metabolic process No
GO:0051540 metal cluster binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0043545 molybdopterin cofactor metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0019720 Mo-molybdopterin cofactor metabolic process No
GO:0009058 biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0008152 metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0003674 molecular_function No
GO:0032991 protein-containing complex No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|004180
MLYRLANTFPRVRALSSLAHIRAKERINVIDSTRPFTGQFIDTFNRKHTYLRISLTERCNLRCFYCMPSEGVELS
PPGHLLTNEEILRLATLFVKSGITKIRLTGGEPSVRKDLLQLMGGLNQLKQYGLTSLAMTTNGIALHRRLPQLVE
NGLTHLNLSLDTLDPFKFEIITRRRGHEAVLKALDTALSLPIQMVKLNVVVIQGLNDSEVLDFIKLTEDRPISVR
FIEFMPFTGNKWDKKKMVPSAQLLERIRTHYPDVTRSSDELNDTARSWYIPGHQGTFGFISSMSDHFCGTCNRLR
LTADGQIKVCLFDPKEISLCDIMRSGASDDELLQVIHQAVVGKKAKHAGMDSIDVTTNRPMILIGHGLVPRARRS
KHDLRALSSATFQSNQRRTYSSASKLTHLDAHGRASMVDVSDKLPSKRAATAKGRIYLTKSAYDLVTFTYPENAQ
LSEAMEKARRKGDVLTTAQIAGIMGAKRTAELVPLCHSLPLSKVDIKLIPETNLQAGADSVEREYSYSILCTATV
TCEGKTGVEMEALMAVSISLLTVWDMLKAVAGKEMEIGKIIVSEKSGGRSGAFSRVL*
Coding >AgabiH97|004180
ATGCTCTACAGACTGGCCAATACGTTTCCCCGTGTGCGCGCACTGTCCTCTTTGGCTCATATTCGTGCAAAAGAA
CGCATCAATGTCATTGACTCAACTAGACCATTCACAGGCCAATTCATAGATACTTTCAACAGAAAGCATACTTAT
CTACGCATCTCTCTTACCGAGAGGTGCAATCTACGATGTTTCTATTGCATGCCGAGTGAAGGCGTAGAGCTTTCA
CCCCCGGGCCATCTCTTGACCAATGAAGAGATCTTACGACTTGCTACACTGTTTGTCAAAAGTGGAATCACAAAG
ATTCGTCTGACTGGTGGAGAACCCTCCGTCCGCAAGGATTTATTGCAGTTGATGGGCGGCTTGAATCAACTGAAG
CAATACGGTCTTACATCCTTAGCCATGACAACAAATGGGATCGCCTTACACAGACGATTACCACAGTTGGTCGAG
AACGGACTAACCCACCTTAACCTCAGTTTGGATACTCTTGACCCCTTCAAATTTGAAATTATAACCCGTCGCCGA
GGCCATGAGGCTGTGTTGAAGGCACTCGACACCGCTCTCAGCTTGCCAATACAAATGGTCAAACTGAACGTAGTC
GTAATCCAGGGATTAAATGACTCTGAAGTCCTCGATTTTATCAAGCTTACCGAAGACAGGCCCATATCTGTCCGG
TTCATTGAATTCATGCCTTTCACTGGAAACAAGTGGGACAAGAAAAAAATGGTTCCATCTGCTCAGCTTCTAGAA
CGCATCAGAACGCATTACCCAGACGTAACGCGCAGCTCAGATGAGTTGAATGACACGGCGCGTTCATGGTATATA
CCTGGTCACCAAGGTACTTTTGGATTTATTAGTAGCATGTCGGACCACTTTTGTGGTACATGCAATCGACTTCGA
CTCACTGCGGATGGCCAGATCAAAGTGTGTCTTTTCGACCCCAAGGAAATTTCGTTGTGCGATATCATGCGGTCA
GGTGCTTCCGACGATGAGCTGCTCCAAGTCATCCACCAAGCGGTAGTTGGCAAGAAGGCGAAACATGCGGGCATG
GATTCCATCGATGTGACTACGAACCGGCCTATGATACTTATAGGTCACGGTCTTGTGCCTCGAGCTAGACGCTCA
AAACATGATCTAAGAGCTTTATCCTCAGCTACTTTTCAATCAAATCAGCGACGTACATATAGCTCTGCATCTAAG
CTGACCCATCTTGATGCGCACGGCAGAGCTTCTATGGTAGATGTGTCCGACAAGTTACCCTCAAAGCGAGCTGCG
ACCGCAAAGGGTCGCATTTACCTAACCAAGTCCGCATATGACCTTGTCACATTCACGTACCCAGAAAATGCTCAA
CTGAGCGAGGCTATGGAAAAAGCGAGGAGAAAGGGTGATGTGTTGACCACCGCACAAATTGCCGGTATTATGGGG
GCCAAGCGAACGGCAGAACTCGTTCCCCTATGCCATTCACTGCCTTTGTCGAAAGTTGATATTAAACTTATTCCG
GAAACCAACCTTCAAGCTGGCGCAGATTCCGTCGAAAGGGAATACAGTTACAGTATACTTTGTACGGCAACTGTG
ACCTGTGAAGGAAAGACAGGTGTGGAGATGGAAGCATTAATGGCTGTATCCATCAGTTTGTTGACGGTCTGGGAC
ATGCTGAAGGCCGTAGCTGGGAAGGAGATGGAAATCGGGAAGATCATCGTTAGCGAGAAAAGCGGCGGAAGAAGC
GGTGCCTTCAGCAGAGTACTGTGA
Transcript >AgabiH97|004180
ATGCTCTACAGACTGGCCAATACGTTTCCCCGTGTGCGCGCACTGTCCTCTTTGGCTCATATTCGTGCAAAAGAA
CGCATCAATGTCATTGACTCAACTAGACCATTCACAGGCCAATTCATAGATACTTTCAACAGAAAGCATACTTAT
CTACGCATCTCTCTTACCGAGAGGTGCAATCTACGATGTTTCTATTGCATGCCGAGTGAAGGCGTAGAGCTTTCA
CCCCCGGGCCATCTCTTGACCAATGAAGAGATCTTACGACTTGCTACACTGTTTGTCAAAAGTGGAATCACAAAG
ATTCGTCTGACTGGTGGAGAACCCTCCGTCCGCAAGGATTTATTGCAGTTGATGGGCGGCTTGAATCAACTGAAG
CAATACGGTCTTACATCCTTAGCCATGACAACAAATGGGATCGCCTTACACAGACGATTACCACAGTTGGTCGAG
AACGGACTAACCCACCTTAACCTCAGTTTGGATACTCTTGACCCCTTCAAATTTGAAATTATAACCCGTCGCCGA
GGCCATGAGGCTGTGTTGAAGGCACTCGACACCGCTCTCAGCTTGCCAATACAAATGGTCAAACTGAACGTAGTC
GTAATCCAGGGATTAAATGACTCTGAAGTCCTCGATTTTATCAAGCTTACCGAAGACAGGCCCATATCTGTCCGG
TTCATTGAATTCATGCCTTTCACTGGAAACAAGTGGGACAAGAAAAAAATGGTTCCATCTGCTCAGCTTCTAGAA
CGCATCAGAACGCATTACCCAGACGTAACGCGCAGCTCAGATGAGTTGAATGACACGGCGCGTTCATGGTATATA
CCTGGTCACCAAGGTACTTTTGGATTTATTAGTAGCATGTCGGACCACTTTTGTGGTACATGCAATCGACTTCGA
CTCACTGCGGATGGCCAGATCAAAGTGTGTCTTTTCGACCCCAAGGAAATTTCGTTGTGCGATATCATGCGGTCA
GGTGCTTCCGACGATGAGCTGCTCCAAGTCATCCACCAAGCGGTAGTTGGCAAGAAGGCGAAACATGCGGGCATG
GATTCCATCGATGTGACTACGAACCGGCCTATGATACTTATAGGTCACGGTCTTGTGCCTCGAGCTAGACGCTCA
AAACATGATCTAAGAGCTTTATCCTCAGCTACTTTTCAATCAAATCAGCGACGTACATATAGCTCTGCATCTAAG
CTGACCCATCTTGATGCGCACGGCAGAGCTTCTATGGTAGATGTGTCCGACAAGTTACCCTCAAAGCGAGCTGCG
ACCGCAAAGGGTCGCATTTACCTAACCAAGTCCGCATATGACCTTGTCACATTCACGTACCCAGAAAATGCTCAA
CTGAGCGAGGCTATGGAAAAAGCGAGGAGAAAGGGTGATGTGTTGACCACCGCACAAATTGCCGGTATTATGGGG
GCCAAGCGAACGGCAGAACTCGTTCCCCTATGCCATTCACTGCCTTTGTCGAAAGTTGATATTAAACTTATTCCG
GAAACCAACCTTCAAGCTGGCGCAGATTCCGTCGAAAGGGAATACAGTTACAGTATACTTTGTACGGCAACTGTG
ACCTGTGAAGGAAAGACAGGTGTGGAGATGGAAGCATTAATGGCTGTATCCATCAGTTTGTTGACGGTCTGGGAC
ATGCTGAAGGCCGTAGCTGGGAAGGAGATGGAAATCGGGAAGATCATCGTTAGCGAGAAAAGCGGCGGAAGAAGC
GGTGCCTTCAGCAGAGTACTGTGA
Gene >AgabiH97|004180
ATGCTCTACAGACTGGCCAATACGTTTCCCCGTGTGCGCGCACTGTCCTCTTTGGCTCATATTCGTGCAAAAGTA
AGCCTGCTCGTGACTTTCGACGCAGATTTCATGAACAACAAATAGGAACGCATCAATGTCATTGACTCAACTAGA
CCATTCACAGGCCAATTCATAGATACTTTCAACAGAAAGCATACTTATCTACGCATCTCTCTTACCGAGAGGTGC
AATCTACGATGTGAGCTTTTAGCCATTGAGTCACCCAGACTCCGTTACGACGCGACATATCAGGTTTCTATTGCA
TGCCGAGTGAAGGCGTAGAGCTTTCACCCCCGGGCCATCTCTTGACCAATGAAGAGATCTTACGACTTGCTACAC
TGTTTGTCAAAAGTGGAATCACAAAGATTCGTCTGACTGGTGGAGAACCCTCCGTCCGCAAGGATTTATTGCAGT
TGATGGGTATGCTGGAATCAGGGAGCGATACTTCCCGCTACTCATAATCTTGTCAGGCGGCTTGAATCAACTGAA
GCAATACGGTCTTACATCCTTAGCCATGACAACAAATGGGATCGCCTTACACAGACGATTACCACAGTTGGTCGA
GAACGGACTAACCCACCTTAACCTCAGTTTGGATACTCTTGACCCCTTCAAATTTGAAATTATAACCCGTCGCCG
AGGCCATGAGGCTGTGTTGAAGGCACTCGACACCGCTCTCAGCTTGCCAATACAAATGGTCAAACTGAACGTAGT
CGTAATCCAGGGATTAAATGACTCTGAAGTCCTCGATTTTATCAAGCTTACCGAAGACAGGCCCATATCTGTCCG
GTTCATTGAATTCATGCCTTTCACTGGTTAGTTCCTCCGTTTCACATGTTCAAGTTGAACTGACCAATCTCTACA
GGAAACAAGTGGGACAAGAAAAAAATGGTTCCATCTGCTCAGCTTCTAGAACGCATCAGAACGCATTACCCAGAC
GTAACGCGCAGCTCAGATGAGTTGAATGACACGGCGCGTTCATGGTATATACCTGGTCACCAAGGTACTTTTGGA
TTTATTAGTAGCATGTCGGACCACTTTTGTGGTACATGCAATCGACTTCGACTCACTGCGGATGGCCAGATCAAA
GTGAGTCGATCAAATCCTCTTTTTGTTCAGCCTTTACATTCATGCAGGTGTGTCTTTTCGACCCCAAGGAAATTT
CGTTGTGCGATATCATGCGGTCAGGTGCTTCCGACGATGAGCTGCTCCAAGTCATCCACCAAGCGGTAGTTGGCA
AGAAGGCGAAACATGCGGGCATGGATTCCATCGATGTGACTACGAACCGGCCTATGATACTTATAGGTGGATAAC
GCTTCTCGTCTTATCTATATACAAAATATACAAGCCTGATCCCTCCTCTCACTGCTCAGGTCACGGTCTTGTGCC
TCGAGCTAGACGCTCAAAACATGATCTAAGAGCTTTATCCTCAGCTACTTTTCAATCAAATCAGCGACGTACATA
TAGCTCTGCATCTAAGCTGACCCATCTTGATGCGCACGGCAGAGCTTCTATGGTAGATGTGTCCGACAAGTTACC
CTCAAAGCGAGCTGCGACCGCAAAGGGTCGCATTTACCTAACCAAGTCCGCATATGACCTTGTCACATTCACGTA
CCCAGAAAATGCTCAACTGAGCGAGGCTATGGAAAAAGCGAGGAGAAAGGGTGATGTGTTGACCACCGCACAAAT
TGCCGGTATTATGGGGGCCAAGCGAACGGCAGAACTCGTTCCCCTATGCCATTCACTGCCTTTGTCGAAAGTTGA
TATTAAACTTATTCCGGAAACCAACCTTCAAGCTGGCGCAGATTCCGTCGAAAGGGAATACAGTTACAGTATACT
TTGTACGGCAACTGTGACCTGTGAAGGAAAGACAGGTGTGGAGATGGAAGCATTAATGGCTGTATCCATCAGTTT
GTTGACGGTCTGGGACATGCTGAAGGCCGTAGCTGGGAAGGAGATGGAAATCGGGAAGATCATCGTTAGCGAGAA
AAGCGGCGGAAGAAGCGGTGCCTTCAGCAGAGTACTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail