Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|003870
Gene name
Locationscaffold_1:957832..960182
Strand+
Gene length (bp)2350
Transcript length (bp)1836
Coding sequence length (bp)1836
Protein length (aa) 612

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 1.6E-14 107 204
PF08241 Methyltransf_11 Methyltransferase domain 9.2E-12 108 207
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 6.3E-08 101 210
PF13489 Methyltransf_23 Methyltransferase domain 2.8E-07 101 210
PF13847 Methyltransf_31 Methyltransferase domain 4.7E-07 105 212
PF00891 Methyltransf_2 O-methyltransferase domain 2.8E-05 95 209

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 102 221 5.0E-09
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 102 221 5.0E-09
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 102 221 5.0E-09
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 102 221 5.0E-09
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 102 221 5.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 102 221 5.0E-09
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 102 221 5.0E-09
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 102 221 5.0E-09
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 102 221 5.0E-09
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 102 221 5.0E-09
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 102 221 6.0E-09
sp|O66128|MENG_MICLU Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 102 210 9.0E-09
sp|Q88SI6|MENG_LACPL Demethylmenaquinone methyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=menG PE=3 SV=1 107 226 2.0E-08
sp|Q73AY2|MENG_BACC1 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menG PE=3 SV=1 106 206 3.0E-08
sp|C3P5A0|MENG_BACAA Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain A0248) GN=menG PE=3 SV=1 106 206 5.0E-08
sp|C3L8S6|MENG_BACAC Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menG PE=3 SV=1 106 206 5.0E-08
sp|Q81SW0|MENG_BACAN Demethylmenaquinone methyltransferase OS=Bacillus anthracis GN=menG PE=3 SV=1 106 206 5.0E-08
sp|B7JGZ8|MENG_BACC0 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH820) GN=menG PE=3 SV=1 106 206 5.0E-08
sp|B7HL23|MENG_BACC7 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH187) GN=menG PE=3 SV=1 106 206 5.0E-08
sp|B9IVN5|MENG_BACCQ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain Q1) GN=menG PE=3 SV=1 106 206 5.0E-08
sp|Q63DL9|MENG_BACCZ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=menG PE=3 SV=1 106 206 5.0E-08
sp|Q6HL42|MENG_BACHK Demethylmenaquinone methyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menG PE=3 SV=1 106 206 5.0E-08
sp|C1EN10|MENG_BACC3 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain 03BB102) GN=menG PE=3 SV=1 106 206 5.0E-08
sp|Q81FQ6|MENG_BACCR Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menG PE=3 SV=1 106 206 7.0E-08
sp|B7HHR7|MENG_BACC4 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain B4264) GN=menG PE=3 SV=1 106 206 7.0E-08
sp|B7IP91|MENG_BACC2 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain G9842) GN=menG PE=3 SV=1 106 206 7.0E-08
sp|Q2YY85|MENG_STAAB Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 98 204 2.0E-07
sp|A7GN50|MENG_BACCN Demethylmenaquinone methyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menG PE=3 SV=1 99 206 2.0E-07
sp|Q6GGU0|MENG_STAAR Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 98 204 2.0E-07
sp|P31113|MENG_BACSU Demethylmenaquinone methyltransferase OS=Bacillus subtilis (strain 168) GN=menG PE=1 SV=1 102 204 2.0E-07
sp|P49016|MENG_LACLA Demethylmenaquinone methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menG PE=3 SV=1 70 210 3.0E-07
sp|Q49XS5|MENG_STAS1 Demethylmenaquinone methyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menG PE=3 SV=1 98 204 4.0E-07
sp|A8FEK9|MENG_BACP2 Demethylmenaquinone methyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=menG PE=3 SV=1 102 204 7.0E-07
sp|Q5KXU0|MENG_GEOKA Demethylmenaquinone methyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=menG PE=3 SV=1 102 204 8.0E-07
sp|A7Z627|MENG_BACMF Demethylmenaquinone methyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menG PE=3 SV=1 102 204 9.0E-07
sp|B9DNV5|MENG_STACT Demethylmenaquinone methyltransferase OS=Staphylococcus carnosus (strain TM300) GN=menG PE=3 SV=1 99 204 1.0E-06
sp|A9VMC2|MENG_BACWK Demethylmenaquinone methyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menG PE=3 SV=1 99 204 1.0E-06
sp|Q65I24|MENG_BACLD Demethylmenaquinone methyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menG PE=3 SV=1 108 204 2.0E-06
sp|Q5N4X9|MENG_SYNP6 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=menG PE=3 SV=1 106 229 4.0E-06
sp|Q31P90|MENG_SYNE7 2-phytyl-1,4-naphtoquinone methyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=menG PE=3 SV=1 106 229 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0008171 O-methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|003870
MTQALAVHHLSSLISSARVSLSGTTTSGQSAASAPSFETRRSTTRKEGHFVYKHGQRHHSYDSEKAPYPLCYDRS
VLDLESLENEFVQRVKGSVSFVDLEQRQSQRVLDLGCGLGTWVIDAAKKCPESEFVGFDLVDVQIPRSILDPSVA
ARIEWRHGNYLTTKLPFEDDEFDHVHISYIANGVPENKWGNLFEEITRVLGPGGSCEIIDEDMIFPILPRWFTQA
LRPRPKTSSVHLPKGFQHKHSSSRDQTTKYTTTHDHALLESLYNSVFENRFINTKPTALLPGLFTSYFRQIAIAP
VLHYPMPPLAPMQSLPPQIVTTYVLEPETDTLNPHQSTIYPTPVPMTRPMSLSLSSVASSHINGTRVDSMYGSRP
GTASPNTTAPESPTSHMAPHGLPKPQTGKCSGVSPPTPPSSPFPTPISQMPMKQFILDEALSAGEEAMSHPQQSR
QMFPFDRLHQLNSRYLAMQLYRCCQCILGCQEAMWEELKDRLRNRKQELIPYGWDDDDELEELQNRTKFEKLVDR
FKNDMHLRLSLWHSLTDLGWNSPDREPLTKAELVEEERIRANILEARKQAKPEEFDIPCRSVRVLVGYLVSSHVF
RVVDHIIVCLP*
Coding >AgabiH97|003870
ATGACACAGGCTCTCGCTGTCCATCACCTCTCTTCCCTAATCTCATCCGCCAGAGTCTCACTGTCAGGTACCACC
ACCAGCGGCCAGTCTGCAGCCTCTGCTCCCAGCTTCGAGACAAGGCGGTCCACAACCCGGAAAGAGGGTCATTTT
GTCTATAAACATGGTCAACGACATCATTCATACGATAGCGAAAAAGCACCATATCCCCTGTGCTATGACCGGTCT
GTTCTCGATCTAGAATCCTTAGAAAACGAATTCGTTCAACGTGTCAAAGGTTCCGTCTCCTTCGTGGACCTAGAG
CAGCGACAATCACAAAGGGTGCTTGACCTTGGATGTGGGCTTGGGACATGGGTGATTGATGCCGCGAAAAAATGT
CCTGAGTCTGAATTCGTTGGTTTCGACTTGGTCGACGTTCAAATACCCCGTTCAATCTTGGACCCCTCGGTCGCA
GCACGGATAGAGTGGAGACATGGCAATTACTTAACAACAAAATTACCGTTTGAGGATGACGAATTTGACCATGTC
CACATTTCGTATATTGCTAACGGAGTTCCGGAAAACAAGTGGGGGAACCTCTTCGAGGAAATTACGAGAGTCCTT
GGGCCAGGTGGTTCCTGTGAAATTATTGACGAGGATATGATATTCCCCATTCTTCCTCGATGGTTCACGCAAGCT
TTGCGGCCGAGGCCGAAAACATCATCCGTTCACCTACCCAAAGGTTTCCAGCACAAACATTCTTCTTCTAGAGAC
CAGACTACGAAGTATACAACGACACACGACCATGCCCTCTTAGAGTCGCTTTATAATTCTGTCTTTGAGAACAGA
TTTATCAACACGAAACCAACAGCCTTACTCCCGGGTCTTTTTACATCGTATTTTCGGCAGATCGCAATAGCGCCT
GTCTTACATTACCCCATGCCGCCTCTAGCACCAATGCAGTCCCTCCCCCCTCAGATCGTTACCACCTACGTTCTA
GAACCCGAAACAGATACGCTGAATCCGCACCAGTCTACCATTTATCCAACGCCAGTGCCAATGACTCGCCCGATG
TCTTTGTCCTTGTCGTCCGTCGCGTCTTCCCATATTAACGGGACCCGAGTCGATTCGATGTATGGTAGTCGACCC
GGGACGGCCTCACCAAATACAACAGCGCCCGAATCTCCTACCTCACACATGGCACCCCACGGTCTTCCAAAACCC
CAGACTGGGAAATGCAGTGGCGTTTCCCCGCCAACTCCACCTTCTTCCCCCTTTCCCACGCCAATTTCGCAGATG
CCAATGAAGCAGTTTATATTGGACGAGGCACTGAGTGCGGGGGAGGAGGCTATGTCTCATCCCCAACAGTCGCGG
CAAATGTTCCCATTTGATCGACTACATCAGCTGAACAGTCGGTATCTTGCAATGCAACTATATCGGTGCTGCCAG
TGTATTCTGGGATGCCAGGAAGCCATGTGGGAAGAACTGAAAGACAGACTACGGAATAGGAAGCAGGAGCTGATA
CCATACGGATGGGATGATGACGATGAGTTGGAGGAGCTGCAGAACAGAACTAAATTCGAGAAACTTGTGGATAGA
TTTAAGAATGACATGCACCTTCGCCTATCCCTCTGGCATTCATTGACAGACCTCGGCTGGAATTCGCCTGACCGT
GAGCCTCTCACGAAAGCCGAGCTCGTCGAAGAAGAACGAATTCGAGCAAACATTTTAGAAGCTAGAAAACAGGCC
AAGCCGGAAGAGTTTGACATTCCTTGTCGCTCTGTCAGAGTCCTCGTTGGATATTTGGTATCTTCCCATGTTTTT
CGTGTAGTGGATCACATCATTGTATGCCTGCCGTAG
Transcript >AgabiH97|003870
ATGACACAGGCTCTCGCTGTCCATCACCTCTCTTCCCTAATCTCATCCGCCAGAGTCTCACTGTCAGGTACCACC
ACCAGCGGCCAGTCTGCAGCCTCTGCTCCCAGCTTCGAGACAAGGCGGTCCACAACCCGGAAAGAGGGTCATTTT
GTCTATAAACATGGTCAACGACATCATTCATACGATAGCGAAAAAGCACCATATCCCCTGTGCTATGACCGGTCT
GTTCTCGATCTAGAATCCTTAGAAAACGAATTCGTTCAACGTGTCAAAGGTTCCGTCTCCTTCGTGGACCTAGAG
CAGCGACAATCACAAAGGGTGCTTGACCTTGGATGTGGGCTTGGGACATGGGTGATTGATGCCGCGAAAAAATGT
CCTGAGTCTGAATTCGTTGGTTTCGACTTGGTCGACGTTCAAATACCCCGTTCAATCTTGGACCCCTCGGTCGCA
GCACGGATAGAGTGGAGACATGGCAATTACTTAACAACAAAATTACCGTTTGAGGATGACGAATTTGACCATGTC
CACATTTCGTATATTGCTAACGGAGTTCCGGAAAACAAGTGGGGGAACCTCTTCGAGGAAATTACGAGAGTCCTT
GGGCCAGGTGGTTCCTGTGAAATTATTGACGAGGATATGATATTCCCCATTCTTCCTCGATGGTTCACGCAAGCT
TTGCGGCCGAGGCCGAAAACATCATCCGTTCACCTACCCAAAGGTTTCCAGCACAAACATTCTTCTTCTAGAGAC
CAGACTACGAAGTATACAACGACACACGACCATGCCCTCTTAGAGTCGCTTTATAATTCTGTCTTTGAGAACAGA
TTTATCAACACGAAACCAACAGCCTTACTCCCGGGTCTTTTTACATCGTATTTTCGGCAGATCGCAATAGCGCCT
GTCTTACATTACCCCATGCCGCCTCTAGCACCAATGCAGTCCCTCCCCCCTCAGATCGTTACCACCTACGTTCTA
GAACCCGAAACAGATACGCTGAATCCGCACCAGTCTACCATTTATCCAACGCCAGTGCCAATGACTCGCCCGATG
TCTTTGTCCTTGTCGTCCGTCGCGTCTTCCCATATTAACGGGACCCGAGTCGATTCGATGTATGGTAGTCGACCC
GGGACGGCCTCACCAAATACAACAGCGCCCGAATCTCCTACCTCACACATGGCACCCCACGGTCTTCCAAAACCC
CAGACTGGGAAATGCAGTGGCGTTTCCCCGCCAACTCCACCTTCTTCCCCCTTTCCCACGCCAATTTCGCAGATG
CCAATGAAGCAGTTTATATTGGACGAGGCACTGAGTGCGGGGGAGGAGGCTATGTCTCATCCCCAACAGTCGCGG
CAAATGTTCCCATTTGATCGACTACATCAGCTGAACAGTCGGTATCTTGCAATGCAACTATATCGGTGCTGCCAG
TGTATTCTGGGATGCCAGGAAGCCATGTGGGAAGAACTGAAAGACAGACTACGGAATAGGAAGCAGGAGCTGATA
CCATACGGATGGGATGATGACGATGAGTTGGAGGAGCTGCAGAACAGAACTAAATTCGAGAAACTTGTGGATAGA
TTTAAGAATGACATGCACCTTCGCCTATCCCTCTGGCATTCATTGACAGACCTCGGCTGGAATTCGCCTGACCGT
GAGCCTCTCACGAAAGCCGAGCTCGTCGAAGAAGAACGAATTCGAGCAAACATTTTAGAAGCTAGAAAACAGGCC
AAGCCGGAAGAGTTTGACATTCCTTGTCGCTCTGTCAGAGTCCTCGTTGGATATTTGGTATCTTCCCATGTTTTT
CGTGTAGTGGATCACATCATTGTATGCCTGCCGTAG
Gene >AgabiH97|003870
ATGACACAGGCTCTCGCTGTCCATCACCTCTCTTCCCTAATCTCATCCGCCAGAGTCTCACTGTCAGGTACCACC
ACCAGCGGCCAGTCTGCAGCCTCTGCTCCCAGCTTCGAGACAAGGCGGTCCACAACCCGGAAAGAGGGTCATTTT
GTCTATAAACATGGTCAACGACATCATTCATACGATAGCGAAAAAGCACCATATCCCCTGTGCTATGACCGGTCT
GTTCTCGATCTGTTAGTCTTCAGAGTGTGATGTCAATAATAGTGTGCCTGGCTGACGGCGCACCACAGAGAATCC
TTAGAAAACGAATTCGTTCAACGTGTCAAAGGTTCCGTCTCCTTCGTGGACCTAGAGCAGCGACAATCACAAAGG
GTGCTTGACCTTGGATGTGGGGTAGGTCATCGTCCGGTGAATCTCGACAATGACCATTCATTTATAGACGAGTGT
AGCTTGGGACATGGGTGATTGATGCCGCGAAAAAATGTCCTGAGTCTGAATTCGTAAGGTCCCATTTCCATTAGA
GGAGCCCCTCTCGCTGAAATCGGCTCAAGGTTGGTTTCGACTTGGTCGACGTTCAAATACCCCGTTCAATCTTGG
ACCCCTCGGTCGCAGCACGGATAGAGTGGAGACATGGCAATTAGTGAGTGGCAGAAACATGACGGTCGATCGGCT
CTGACATCGTGCCCCCCAGCTTAACAACAAAATTACCGTTTGAGGATGACGAATTTGACCATGTCCACATTTCGT
ATATTGCTAACGGAGTTCCGGAAAACAAGGTAAGAAATCGATACTTGTTTTGTACTTCTTTATCCATCTACTTAT
AGTGGGGGAACCTCTTCGAGGTGAGTGCGACGGCACACAGGCATTCAAAACCCAGGTACTAACAATCATAGGAAA
TTACGAGAGTCCTTGGGCCAGGTGGTTCCTGTGAAATTATTGACGAGGGTTTGTACTCATTCATTCATACATATA
GCATGTATTGATGACGGTGATAGATATGATATTCCCCATTCTTCCTCGATGGTTCACGCAAGCTTTGCGGCCGAG
GCCGAAAACATCATCCGTTCACCTACCCAAAGGTTTCCAGCACAAACATTCTTCTTCTAGAGACCAGACTACGAA
GTATACAACGACACACGACCATGCCCTCTTAGAGTCGCTTTATAATTCTGTCTTTGAGAACAGATTTATCAACAC
GAAACCAACAGGTAAGAAACTATCATCAGACTATTGGCAATGTTGACCTTTTGCCAGCCTTACTCCCGGGTCTTT
TTACATCGTATTTTCGGCAGATCGCAATAGCGCCTGTCTTACATTACCCCATGCCGCCTCTAGCACCAATGCAGT
CCCTCCCCCCTCAGATCGTTACCACCTACGTTCTAGAACCCGAAACAGATACGCTGAATCCGCACCAGTCTACCA
TTTATCCAACGCCAGTGCCAATGACTCGCCCGATGTCTTTGTCCTTGTCGTCCGTCGCGTCTTCCCATATTAACG
GGACCCGAGTCGATTCGATGTATGGTAGTCGACCCGGGACGGCCTCACCAAATACAACAGCGCCCGAATCTCCTA
CCTCACACATGGCACCCCACGGTCTTCCAAAACCCCAGACTGGGAAATGCAGTGGCGTTTCCCCGCCAACTCCAC
CTTCTTCCCCCTTTCCCACGCCAATTTCGCAGATGCCAATGAAGCAGTTTATATTGGACGAGGCACTGAGTGCGG
GGGAGGAGGCTATGTCTCATCCCCAACAGTCGCGGCAAATGTTCCCATTTGATCGACTACATCAGCTGAACAGTC
GGTATCTTGCAATGCAACTATATCGGTGCTGCCAGTGTATTCTGGGATGCCAGGAAGCCATGTGGGAAGAACTGA
AAGACAGACTACGGAATAGGAAGCAGGAGCTGATACCATACGGATGGGATGATGACGATGAGTTGGAGGAGCTGC
AGAACAGAACTAAATTCGAGAAACTTGTGGATAGATTTAAGAAGTAAGTTTCCCATCTCTTGGTAGGGCACCACT
CCAATCGTGACTTTCTAGTGACATGCACCTTCGCCTATCCCTCTGGCATTCATTGACAGACCTCGGCTGGAATTC
GCCTGACCGTGAGCCTCTCACGAAAGCCGAGCTCGTCGAAGAAGAACGAATTCGAGCAAACATTTTAGAAGCTAG
AAAACAGGCCAAGCCGGAAGAGTTTGACATTCCTTGTCGCTCTGTCAGAGTCCTCGTTGGATGTAAATTATGATG
ATTTTATGTTCGTTTTATGATTGTATTGTTTTAACTTACAGATTTGGTATCTTCCCATGTTTTTCGTGTAGTGGA
TCACATCATTGTATGCCTGCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail