Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|003830
Gene name
Locationscaffold_1:949147..951500
Strand-
Gene length (bp)2353
Transcript length (bp)2013
Coding sequence length (bp)2013
Protein length (aa) 671

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family 4.8E-10 25 220
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 3.5E-07 24 227

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5BAA2|RHA1_EMENI Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN2528 PE=1 SV=1 15 228 2.0E-54
sp|Q00017|RHA1_ASPAC Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus GN=rha1 PE=1 SV=1 15 228 2.0E-46
sp|O31528|RHGT2_BACSU Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) GN=yesY PE=1 SV=1 21 220 7.0E-10
sp|O31523|RHGT1_BACSU Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) GN=rhgT PE=1 SV=1 21 93 4.0E-06

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 55.71 33.30 78.12
Initials Initials knots 45.96 27.63 64.28
Pileal_Stipeal_center Stage I stipe center 50.66 30.50 70.81
Pileal_Stipeal_shell Stage I stipe shell 52.87 31.74 74.00
DIF_stipe_center Stage II stipe center 57.22 34.41 80.02
DIF_stipe_shell Stage II stipe shell 60.47 36.34 84.61
DIF_stipe_skin Stage II stipe skin 49.30 29.55 69.05
DIF_cap_skin Stage II cap skin 62.67 37.61 87.73
DIF_cap_tissue Stage II cap tissue 67.43 40.30 94.56
DIF_gill_tissue Stage II gill tissue 60.37 36.19 84.55
YFB_stipe_center Young fruiting body stipe center 57.32 34.46 80.19
YFB_stipe_shell Young fruiting body stipe shell 69.66 41.61 97.72
YFB_stipe_skin Young fruiting body stipe skin 59.01 35.41 82.60
YFB_cap_skin Young fruiting body cap skin 75.81 45.31 106.31
YFB_cap_tissue Young fruiting body cap tissue 92.37 54.23 130.51
YFB_gill_tissue Young fruiting body gill tissue 63.59 38.19 88.99
YFB_veil Young fruiting body veil 60.19 36.18 84.20

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.866879 no
Casing YFB_stipe_center 0.957951 no
Casing YFB_stipe_shell 0.523681 no
Casing YFB_stipe_skin 0.910410 no
Casing YFB_cap_skin 0.323252 no
Casing YFB_cap_tissue 0.063954 no
Casing YFB_gill_tissue 0.753433 no
Casing YFB_veil 0.870950 no
Casing Initials 0.601321 no
Casing Pileal_Stipeal_center 0.837973 no
Casing Pileal_Stipeal_shell 0.917613 no
Casing DIF_stipe_center 0.960941 no
Casing DIF_stipe_shell 0.863053 no
Casing DIF_stipe_skin 0.780069 no
Casing DIF_cap_skin 0.784019 no
Casing DIF_cap_tissue 0.613226 no
DIF_gill_tissue YFB_stipe_center 0.920408 no
DIF_gill_tissue YFB_stipe_shell 0.728260 no
DIF_gill_tissue YFB_stipe_skin 0.966472 no
DIF_gill_tissue YFB_cap_skin 0.516827 no
DIF_gill_tissue YFB_cap_tissue 0.139267 no
DIF_gill_tissue YFB_gill_tissue 0.919675 no
DIF_gill_tissue YFB_veil 0.994587 no
YFB_stipe_center YFB_stipe_shell 0.598702 no
YFB_stipe_center YFB_stipe_skin 0.956864 no
YFB_stipe_center YFB_cap_skin 0.391120 no
YFB_stipe_center YFB_cap_tissue 0.087927 no
YFB_stipe_center YFB_gill_tissue 0.817463 no
YFB_stipe_center YFB_veil 0.924653 no
YFB_stipe_shell YFB_stipe_skin 0.676057 no
YFB_stipe_shell YFB_cap_skin 0.862967 no
YFB_stipe_shell YFB_cap_tissue 0.397375 no
YFB_stipe_shell YFB_gill_tissue 0.845429 no
YFB_stipe_shell YFB_veil 0.722630 no
YFB_stipe_skin YFB_cap_skin 0.459057 no
YFB_stipe_skin YFB_cap_tissue 0.114888 no
YFB_stipe_skin YFB_gill_tissue 0.875444 no
YFB_stipe_skin YFB_veil 0.970686 no
YFB_cap_skin YFB_cap_tissue 0.611517 no
YFB_cap_skin YFB_gill_tissue 0.651577 no
YFB_cap_skin YFB_veil 0.511942 no
YFB_cap_tissue YFB_gill_tissue 0.214476 no
YFB_cap_tissue YFB_veil 0.134002 no
YFB_gill_tissue YFB_veil 0.913436 no
Initials DIF_gill_tissue 0.403765 no
Initials YFB_stipe_center 0.529153 no
Initials YFB_stipe_shell 0.139267 no
Initials YFB_stipe_skin 0.457904 no
Initials YFB_cap_skin 0.063760 no
Initials YFB_cap_tissue 0.004160 yes
Initials YFB_gill_tissue 0.286904 no
Initials YFB_veil 0.406282 no
Initials Pileal_Stipeal_center 0.833015 no
Initials Pileal_Stipeal_shell 0.733871 no
Initials DIF_stipe_center 0.531367 no
Initials DIF_stipe_shell 0.397296 no
Initials DIF_stipe_skin 0.887298 no
Initials DIF_cap_skin 0.313162 no
Initials DIF_cap_tissue 0.191804 no
Pileal_Stipeal_center DIF_gill_tissue 0.648253 no
Pileal_Stipeal_center YFB_stipe_center 0.772562 no
Pileal_Stipeal_center YFB_stipe_shell 0.305249 no
Pileal_Stipeal_center YFB_stipe_skin 0.705609 no
Pileal_Stipeal_center YFB_cap_skin 0.160388 no
Pileal_Stipeal_center YFB_cap_tissue 0.021056 yes
Pileal_Stipeal_center YFB_gill_tissue 0.509961 no
Pileal_Stipeal_center YFB_veil 0.653106 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.934376 no
Pileal_Stipeal_center DIF_stipe_center 0.776430 no
Pileal_Stipeal_center DIF_stipe_shell 0.639158 no
Pileal_Stipeal_center DIF_stipe_skin 0.961776 no
Pileal_Stipeal_center DIF_cap_skin 0.543414 no
Pileal_Stipeal_center DIF_cap_tissue 0.382899 no
Pileal_Stipeal_shell DIF_gill_tissue 0.748567 no
Pileal_Stipeal_shell YFB_stipe_center 0.864989 no
Pileal_Stipeal_shell YFB_stipe_shell 0.392818 no
Pileal_Stipeal_shell YFB_stipe_skin 0.799192 no
Pileal_Stipeal_shell YFB_cap_skin 0.221592 no
Pileal_Stipeal_shell YFB_cap_tissue 0.030610 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.619399 no
Pileal_Stipeal_shell YFB_veil 0.754191 no
Pileal_Stipeal_shell DIF_stipe_center 0.867800 no
Pileal_Stipeal_shell DIF_stipe_shell 0.740324 no
Pileal_Stipeal_shell DIF_stipe_skin 0.888481 no
Pileal_Stipeal_shell DIF_cap_skin 0.652005 no
Pileal_Stipeal_shell DIF_cap_tissue 0.477715 no
DIF_stipe_center DIF_gill_tissue 0.915332 no
DIF_stipe_center YFB_stipe_center 0.996972 no
DIF_stipe_center YFB_stipe_shell 0.592128 no
DIF_stipe_center YFB_stipe_skin 0.953928 no
DIF_stipe_center YFB_cap_skin 0.381638 no
DIF_stipe_center YFB_cap_tissue 0.080353 no
DIF_stipe_center YFB_gill_tissue 0.810482 no
DIF_stipe_center YFB_veil 0.919839 no
DIF_stipe_center DIF_stipe_shell 0.910762 no
DIF_stipe_center DIF_stipe_skin 0.715599 no
DIF_stipe_center DIF_cap_skin 0.842745 no
DIF_stipe_center DIF_cap_tissue 0.678980 no
DIF_stipe_shell DIF_gill_tissue 0.996937 no
DIF_stipe_shell YFB_stipe_center 0.915644 no
DIF_stipe_shell YFB_stipe_shell 0.731599 no
DIF_stipe_shell YFB_stipe_skin 0.963671 no
DIF_stipe_shell YFB_cap_skin 0.520071 no
DIF_stipe_shell YFB_cap_tissue 0.138841 no
DIF_stipe_shell YFB_gill_tissue 0.920926 no
DIF_stipe_shell YFB_veil 0.992461 no
DIF_stipe_shell DIF_stipe_skin 0.574237 no
DIF_stipe_shell DIF_cap_skin 0.944848 no
DIF_stipe_shell DIF_cap_tissue 0.806738 no
DIF_stipe_skin DIF_gill_tissue 0.583859 no
DIF_stipe_skin YFB_stipe_center 0.711169 no
DIF_stipe_skin YFB_stipe_shell 0.253793 no
DIF_stipe_skin YFB_stipe_skin 0.639488 no
DIF_stipe_skin YFB_cap_skin 0.128525 no
DIF_stipe_skin YFB_cap_tissue 0.015819 yes
DIF_stipe_skin YFB_gill_tissue 0.446701 no
DIF_stipe_skin YFB_veil 0.586251 no
DIF_stipe_skin DIF_cap_skin 0.482755 no
DIF_stipe_skin DIF_cap_tissue 0.328972 no
DIF_cap_skin DIF_gill_tissue 0.943212 no
DIF_cap_skin YFB_stipe_center 0.848645 no
DIF_cap_skin YFB_stipe_shell 0.813508 no
DIF_cap_skin YFB_stipe_skin 0.904443 no
DIF_cap_skin YFB_cap_skin 0.606594 no
DIF_cap_skin YFB_cap_tissue 0.179578 no
DIF_cap_skin YFB_gill_tissue 0.977753 no
DIF_cap_skin YFB_veil 0.937256 no
DIF_cap_skin DIF_cap_tissue 0.880906 no
DIF_cap_tissue DIF_gill_tissue 0.808363 no
DIF_cap_tissue YFB_stipe_center 0.689330 no
DIF_cap_tissue YFB_stipe_shell 0.951537 no
DIF_cap_tissue YFB_stipe_skin 0.756067 no
DIF_cap_tissue YFB_cap_skin 0.798644 no
DIF_cap_tissue YFB_cap_tissue 0.332099 no
DIF_cap_tissue YFB_gill_tissue 0.908196 no
DIF_cap_tissue YFB_veil 0.800214 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|003830
MVTLRYLGLFLSVVSVASQTVRLAGDSTMAVGGGGSGTQGWGVFLAQFLTIPVVNNAIGGESARSYNDQGLFTDL
IENTQKGDYVIIEFGHNDGSAGAIDNGKQDAVGDGYNITSVVTTSSGSQILIHSFAFYIENAITALLRKGAIPII
SSQTPDNIWIDGAIAGPNRFVTYARSIGSRRNVTYVDHYAYVASAFNTLGQIQTTTFYPNDHLHTNAAGALVVAE
AFLDKPFQESSDGLSMAKATMLRNASRWPTSTLRSMDDRSSTLRPDARSIDANTARSSLDRHSTAKPSAGGLDRL
KEGALPTRSLVALSTPHDQVLERMYSHPRRSESALALPFPSSLDARHPPLRVRSKTGGSEMASTQARIVNEPANS
GEGPLGATPPVSSASNTLPAPTLYDPFDGSPLGTVLPPEAPTHEDGMSVHIEGSNEELWAHLSRVLDLQKQIARM
HVDMEGLGQGKPTDGKGKGAAFAFPRATSTGSEPEHEIGDEEGVGVVDEEAEKLRARESEFKKLATQFEGRKEAI
NEVMSKLDDLSDALTEFHHLQAPKIEFRSTSRNNSADPSYGEQPQTHARSQSGTSSFVNTSDSSVRSPPAPKPTP
AFHFQPMSHVHTAISAEPDAERQLLIPSLGRKESMVLPLIIEPESDSPGRMVDSPLSSASLKLPSENNPQ*
Coding >AgabiH97|003830
ATGGTTACTCTTCGGTACCTTGGATTATTTCTCTCCGTTGTTTCCGTTGCATCGCAGACCGTTAGGCTTGCGGGT
GATTCAACAATGGCGGTAGGAGGAGGCGGTAGCGGTACGCAAGGATGGGGCGTATTCCTGGCACAGTTCTTGACT
ATCCCCGTCGTCAACAATGCTATTGGGGGTGAAAGTGCTAGGTCATATAATGACCAAGGGTTATTCACAGATCTG
ATTGAAAACACTCAGAAGGGCGACTATGTCATAATCGAATTTGGTCACAATGATGGGAGTGCAGGCGCAATTGAC
AACGGAAAGCAGGATGCCGTCGGCGACGGCTACAATATAACAAGTGTTGTCACTACATCGAGTGGTTCCCAAATC
TTGATCCACAGCTTTGCCTTCTACATCGAAAATGCTATAACTGCTTTACTCCGGAAGGGTGCTATACCCATCATC
TCGTCACAGACCCCAGACAACATCTGGATCGACGGTGCCATTGCAGGCCCCAACAGGTTTGTAACTTACGCTCGG
AGCATTGGGTCTCGAAGAAATGTCACCTATGTCGACCATTATGCATACGTTGCTTCCGCCTTCAATACCCTCGGC
CAAATACAAACCACGACATTCTATCCGAATGATCATCTTCATACAAATGCTGCTGGCGCCCTTGTCGTAGCCGAA
GCCTTTCTGGACAAGCCGTTCCAGGAGAGTAGTGATGGGCTAAGCATGGCGAAGGCGACGATGCTCCGCAACGCC
TCTCGATGGCCGACATCGACATTGAGGTCCATGGACGATCGCAGCTCAACTCTCAGACCAGATGCCCGTTCAATA
GATGCCAATACTGCGCGATCGTCTCTTGACCGTCACTCTACAGCGAAACCGAGTGCAGGCGGCTTAGATCGACTG
AAGGAGGGCGCACTACCAACAAGGAGCTTGGTTGCTCTGAGCACACCTCATGACCAGGTTCTAGAGAGAATGTAC
AGCCATCCGCGCAGGTCTGAAAGTGCCCTTGCCCTTCCTTTTCCCAGCTCGCTGGATGCCAGGCACCCGCCACTC
CGTGTTCGATCTAAAACGGGTGGAAGTGAGATGGCTTCCACCCAAGCACGCATCGTAAATGAACCTGCGAATTCC
GGTGAAGGCCCTTTGGGTGCAACTCCTCCTGTCTCCTCTGCCAGCAACACCCTGCCAGCACCTACACTATACGAC
CCCTTCGACGGTTCTCCCCTTGGTACCGTCCTCCCACCAGAAGCCCCCACACACGAAGACGGCATGTCCGTACAT
ATAGAAGGATCCAACGAGGAATTATGGGCACACCTTTCGCGAGTGCTCGACCTTCAGAAACAGATCGCTCGGATG
CATGTCGACATGGAGGGTCTTGGCCAGGGAAAGCCGACGGATGGCAAGGGGAAAGGGGCCGCTTTCGCTTTCCCG
AGAGCAACCAGTACTGGCTCTGAGCCTGAGCATGAAATCGGTGACGAAGAGGGCGTTGGGGTTGTCGATGAGGAG
GCAGAGAAACTGAGAGCTAGGGAAAGTGAATTCAAGAAGTTGGCAACACAATTCGAGGGCAGAAAGGAAGCAATT
AACGAAGTGATGTCCAAGCTCGATGACCTCTCTGATGCTCTGACAGAATTTCACCACCTACAAGCTCCGAAAATT
GAATTTCGAAGCACGTCGCGTAACAACTCAGCTGATCCCAGCTACGGCGAACAGCCTCAGACTCACGCCAGGTCA
CAGAGTGGTACTTCATCCTTCGTCAATACCAGCGATTCTAGCGTCCGGTCTCCTCCTGCACCTAAGCCTACTCCC
GCGTTTCACTTTCAACCAATGTCACACGTGCACACCGCTATATCAGCCGAACCTGATGCAGAACGTCAACTTCTT
ATCCCTTCCTTGGGCCGTAAAGAATCTATGGTTCTTCCTCTTATCATTGAGCCTGAATCTGATTCCCCGGGTCGC
ATGGTTGACAGTCCACTTTCTTCCGCTAGTCTGAAGTTACCATCTGAGAACAACCCTCAGTGA
Transcript >AgabiH97|003830
ATGGTTACTCTTCGGTACCTTGGATTATTTCTCTCCGTTGTTTCCGTTGCATCGCAGACCGTTAGGCTTGCGGGT
GATTCAACAATGGCGGTAGGAGGAGGCGGTAGCGGTACGCAAGGATGGGGCGTATTCCTGGCACAGTTCTTGACT
ATCCCCGTCGTCAACAATGCTATTGGGGGTGAAAGTGCTAGGTCATATAATGACCAAGGGTTATTCACAGATCTG
ATTGAAAACACTCAGAAGGGCGACTATGTCATAATCGAATTTGGTCACAATGATGGGAGTGCAGGCGCAATTGAC
AACGGAAAGCAGGATGCCGTCGGCGACGGCTACAATATAACAAGTGTTGTCACTACATCGAGTGGTTCCCAAATC
TTGATCCACAGCTTTGCCTTCTACATCGAAAATGCTATAACTGCTTTACTCCGGAAGGGTGCTATACCCATCATC
TCGTCACAGACCCCAGACAACATCTGGATCGACGGTGCCATTGCAGGCCCCAACAGGTTTGTAACTTACGCTCGG
AGCATTGGGTCTCGAAGAAATGTCACCTATGTCGACCATTATGCATACGTTGCTTCCGCCTTCAATACCCTCGGC
CAAATACAAACCACGACATTCTATCCGAATGATCATCTTCATACAAATGCTGCTGGCGCCCTTGTCGTAGCCGAA
GCCTTTCTGGACAAGCCGTTCCAGGAGAGTAGTGATGGGCTAAGCATGGCGAAGGCGACGATGCTCCGCAACGCC
TCTCGATGGCCGACATCGACATTGAGGTCCATGGACGATCGCAGCTCAACTCTCAGACCAGATGCCCGTTCAATA
GATGCCAATACTGCGCGATCGTCTCTTGACCGTCACTCTACAGCGAAACCGAGTGCAGGCGGCTTAGATCGACTG
AAGGAGGGCGCACTACCAACAAGGAGCTTGGTTGCTCTGAGCACACCTCATGACCAGGTTCTAGAGAGAATGTAC
AGCCATCCGCGCAGGTCTGAAAGTGCCCTTGCCCTTCCTTTTCCCAGCTCGCTGGATGCCAGGCACCCGCCACTC
CGTGTTCGATCTAAAACGGGTGGAAGTGAGATGGCTTCCACCCAAGCACGCATCGTAAATGAACCTGCGAATTCC
GGTGAAGGCCCTTTGGGTGCAACTCCTCCTGTCTCCTCTGCCAGCAACACCCTGCCAGCACCTACACTATACGAC
CCCTTCGACGGTTCTCCCCTTGGTACCGTCCTCCCACCAGAAGCCCCCACACACGAAGACGGCATGTCCGTACAT
ATAGAAGGATCCAACGAGGAATTATGGGCACACCTTTCGCGAGTGCTCGACCTTCAGAAACAGATCGCTCGGATG
CATGTCGACATGGAGGGTCTTGGCCAGGGAAAGCCGACGGATGGCAAGGGGAAAGGGGCCGCTTTCGCTTTCCCG
AGAGCAACCAGTACTGGCTCTGAGCCTGAGCATGAAATCGGTGACGAAGAGGGCGTTGGGGTTGTCGATGAGGAG
GCAGAGAAACTGAGAGCTAGGGAAAGTGAATTCAAGAAGTTGGCAACACAATTCGAGGGCAGAAAGGAAGCAATT
AACGAAGTGATGTCCAAGCTCGATGACCTCTCTGATGCTCTGACAGAATTTCACCACCTACAAGCTCCGAAAATT
GAATTTCGAAGCACGTCGCGTAACAACTCAGCTGATCCCAGCTACGGCGAACAGCCTCAGACTCACGCCAGGTCA
CAGAGTGGTACTTCATCCTTCGTCAATACCAGCGATTCTAGCGTCCGGTCTCCTCCTGCACCTAAGCCTACTCCC
GCGTTTCACTTTCAACCAATGTCACACGTGCACACCGCTATATCAGCCGAACCTGATGCAGAACGTCAACTTCTT
ATCCCTTCCTTGGGCCGTAAAGAATCTATGGTTCTTCCTCTTATCATTGAGCCTGAATCTGATTCCCCGGGTCGC
ATGGTTGACAGTCCACTTTCTTCCGCTAGTCTGAAGTTACCATCTGAGAACAACCCTCAGTGA
Gene >AgabiH97|003830
ATGGTTACTCTTCGGTACCTTGGATTATTTCTCTCCGTTGTTTCCGTTGCATCGCAGACCGTTAGGCTTGCGGGT
GATTCAACAATGGCGGTAGGAGGAGGCGGTAGCGGTACGCAAGGTGCGCATTACCGCATGTCAAATCTCTTTAGG
TGGATGTTTACCCTTGAAGTTAGGATGGGGCGTATTCCTGGCACAGTTCTTGACTATCCCCGTCGTCAACAATGC
TATTGGGGGTGAAAGTGCTAGGTCATATAATGACCAAGGGTTATTCACAGATCTGATTGAAAACACTCAGAAGGG
CGACTATGTCATAATCGAATTTGGTCACAATGATGGGAGTGCAGGCGCAATTGACAACGGAAAGCAGGATGCCGT
CGGCGACGGCTACAATATAACAAGTGTTGTCACTACATCGAGGCAAGTGGTTCAATACATGACGTTCATGCTGAG
ATTCACATATGATCACGTCAGTGGTTCCCAAATCTTGATCCACAGCTTTGCCTTCTACATCGAAAATGCTATAAC
TGCTTTACTCCGGAAGGGTGCTATACCCATCATCTCGTCACAGACCCCAGACAACATCTGGATCGACGGTGCCAT
TGCAGGCCCCAACAGGTTTGTAACTTACGCTCGGAGCATTGGGTCTCGAAGAAATGTCACCTATGTCGACCATTA
TGCATACGTTGCTTCCGCCTTCAATACCCTCGGCCAAATACAAACCACGACATTCTATCCGAATGATCATCTTCA
TACAAATGCTGCTGGCGCCCTTGTCGTAGCCGAAGCCTTTGTGCGCGGGTTGTTGTGTGGAAACAATTCCTTAAG
GTCAAGGGTCAATTCAGCTGGACAAGCCGTTCCAGGTACCACTTACCTTGTACTGAGTCTATATTTTGAGCTATC
TGACTCGCGTTACAGGAGAGTGTGTGTGATCAGCGTACTCGGTTGTATCGTAAAGTACTCGAATAGATACTCTCT
GAAGGTCCACGTGATAGAGTGATGGGCTAAGCATGGCGAAGGCGACGATGCTCCGCAACGCCTCTCGATGGCCGA
CATCGACATTGAGGTCCATGGACGATCGCAGCTCAACTCTCAGACCAGATGCCCGTTCAATAGATGCCAATACTG
CGCGATCGTCTCTTGACCGTCACTCTACAGCGAAACCGAGTGCAGGCGGCTTAGATCGACTGAAGGAGGGCGCAC
TACCAACAAGGAGCTTGGTTGCTCTGAGCACACCTCATGACCAGGTTCTAGAGAGAATGTACAGCCATCCGCGCA
GGTCTGAAAGTGCCCTTGCCCTTCCTTTTCCCAGCTCGCTGGATGCCAGGCACCCGCCACTCCGTGTTCGATCTA
AAACGGGTGGAAGTGAGATGGCTTCCACCCAAGCACGCATCGTAAATGAACCTGCGAATTCCGGTGAAGGCCCTT
TGGGTGCAACTCCTCCTGTCTCCTCTGCCAGCAACACCCTGCCAGCACCTACACTATACGACCCCTTCGACGGTT
CTCCCCTTGGTACCGTCCTCCCACCAGAAGCCCCCACACACGAAGACGGCATGTCCGTACATATAGAAGGATCCA
ACGAGGAATTATGGGCACACCTTTCGCGAGTGCTCGACCTTCAGAAACAGATCGCTCGGATGCATGTCGACATGG
AGGGTCTTGGCCAGGGAAAGCCGACGGATGGCAAGGGGAAAGGGGCCGCTTTCGCTTTCCCGAGAGCAACCAGTA
CTGGCTCTGAGCCTGAGCATGAAATCGGTGACGAAGAGGGCGTTGGGGTTGTCGATGAGGAGGCAGAGAAACTGA
GAGCTAGGGAAAGTGAATTCAAGAAGTTGGCAACACAATTCGAGGGCAGAAAGGAAGCAATTAACGAAGTGATGT
CCAAGGTCAATATTCCACTCATAACATTCAACTACATCTAACTAATAGCTCTTTCCAGCTCGATGACCTCTCTGA
TGCTCTGACAGAATTTCACCACCTACAAGCTCCGAAAATTGAATTTCGAAGCACGTCGCGTAACAACTCAGCTGA
TCCCAGCTACGGCGAACAGCCTCAGACTCACGCCAGGTCACAGAGTGGTACTTCATCCTTCGTCAATACCAGCGA
TTCTAGCGTCCGGTCTCCTCCTGCACCTAAGCCTACTCCCGCGTTTCACTTTCAACCAATGTCACACGTGCACAC
CGCTATATCAGCCGAACCTGATGCAGAACGTCAACTTCTTATCCCTTCCTTGGGCCGTAAAGAATCTATGGTTCT
TCCTCTTATCATTGAGCCTGAATCTGATTCCCCGGGTCGCATGGTTGACAGTCCACTTTCTTCCGCTAGTCTGAA
GTTACCATCTGAGAACAACCCTCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail