Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|003830
Gene name
Locationscaffold_1:949147..951500
Strand-
Gene length (bp)2353
Transcript length (bp)2013
Coding sequence length (bp)2013
Protein length (aa) 671

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13472 Lipase_GDSL_2 GDSL-like Lipase/Acylhydrolase family 4.8E-10 25 220
PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase 3.5E-07 24 227

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5BAA2|RHA1_EMENI Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN2528 PE=1 SV=1 15 228 2.0E-54
sp|Q00017|RHA1_ASPAC Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus GN=rha1 PE=1 SV=1 15 228 2.0E-46
sp|O31528|RHGT2_BACSU Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) GN=yesY PE=1 SV=1 21 220 7.0E-10
sp|O31523|RHGT1_BACSU Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) GN=rhgT PE=1 SV=1 21 93 4.0E-06

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|003830
MVTLRYLGLFLSVVSVASQTVRLAGDSTMAVGGGGSGTQGWGVFLAQFLTIPVVNNAIGGESARSYNDQGLFTDL
IENTQKGDYVIIEFGHNDGSAGAIDNGKQDAVGDGYNITSVVTTSSGSQILIHSFAFYIENAITALLRKGAIPII
SSQTPDNIWIDGAIAGPNRFVTYARSIGSRRNVTYVDHYAYVASAFNTLGQIQTTTFYPNDHLHTNAAGALVVAE
AFLDKPFQESSDGLSMAKATMLRNASRWPTSTLRSMDDRSSTLRPDARSIDANTARSSLDRHSTAKPSAGGLDRL
KEGALPTRSLVALSTPHDQVLERMYSHPRRSESALALPFPSSLDARHPPLRVRSKTGGSEMASTQARIVNEPANS
GEGPLGATPPVSSASNTLPAPTLYDPFDGSPLGTVLPPEAPTHEDGMSVHIEGSNEELWAHLSRVLDLQKQIARM
HVDMEGLGQGKPTDGKGKGAAFAFPRATSTGSEPEHEIGDEEGVGVVDEEAEKLRARESEFKKLATQFEGRKEAI
NEVMSKLDDLSDALTEFHHLQAPKIEFRSTSRNNSADPSYGEQPQTHARSQSGTSSFVNTSDSSVRSPPAPKPTP
AFHFQPMSHVHTAISAEPDAERQLLIPSLGRKESMVLPLIIEPESDSPGRMVDSPLSSASLKLPSENNPQ*
Coding >AgabiH97|003830
ATGGTTACTCTTCGGTACCTTGGATTATTTCTCTCCGTTGTTTCCGTTGCATCGCAGACCGTTAGGCTTGCGGGT
GATTCAACAATGGCGGTAGGAGGAGGCGGTAGCGGTACGCAAGGATGGGGCGTATTCCTGGCACAGTTCTTGACT
ATCCCCGTCGTCAACAATGCTATTGGGGGTGAAAGTGCTAGGTCATATAATGACCAAGGGTTATTCACAGATCTG
ATTGAAAACACTCAGAAGGGCGACTATGTCATAATCGAATTTGGTCACAATGATGGGAGTGCAGGCGCAATTGAC
AACGGAAAGCAGGATGCCGTCGGCGACGGCTACAATATAACAAGTGTTGTCACTACATCGAGTGGTTCCCAAATC
TTGATCCACAGCTTTGCCTTCTACATCGAAAATGCTATAACTGCTTTACTCCGGAAGGGTGCTATACCCATCATC
TCGTCACAGACCCCAGACAACATCTGGATCGACGGTGCCATTGCAGGCCCCAACAGGTTTGTAACTTACGCTCGG
AGCATTGGGTCTCGAAGAAATGTCACCTATGTCGACCATTATGCATACGTTGCTTCCGCCTTCAATACCCTCGGC
CAAATACAAACCACGACATTCTATCCGAATGATCATCTTCATACAAATGCTGCTGGCGCCCTTGTCGTAGCCGAA
GCCTTTCTGGACAAGCCGTTCCAGGAGAGTAGTGATGGGCTAAGCATGGCGAAGGCGACGATGCTCCGCAACGCC
TCTCGATGGCCGACATCGACATTGAGGTCCATGGACGATCGCAGCTCAACTCTCAGACCAGATGCCCGTTCAATA
GATGCCAATACTGCGCGATCGTCTCTTGACCGTCACTCTACAGCGAAACCGAGTGCAGGCGGCTTAGATCGACTG
AAGGAGGGCGCACTACCAACAAGGAGCTTGGTTGCTCTGAGCACACCTCATGACCAGGTTCTAGAGAGAATGTAC
AGCCATCCGCGCAGGTCTGAAAGTGCCCTTGCCCTTCCTTTTCCCAGCTCGCTGGATGCCAGGCACCCGCCACTC
CGTGTTCGATCTAAAACGGGTGGAAGTGAGATGGCTTCCACCCAAGCACGCATCGTAAATGAACCTGCGAATTCC
GGTGAAGGCCCTTTGGGTGCAACTCCTCCTGTCTCCTCTGCCAGCAACACCCTGCCAGCACCTACACTATACGAC
CCCTTCGACGGTTCTCCCCTTGGTACCGTCCTCCCACCAGAAGCCCCCACACACGAAGACGGCATGTCCGTACAT
ATAGAAGGATCCAACGAGGAATTATGGGCACACCTTTCGCGAGTGCTCGACCTTCAGAAACAGATCGCTCGGATG
CATGTCGACATGGAGGGTCTTGGCCAGGGAAAGCCGACGGATGGCAAGGGGAAAGGGGCCGCTTTCGCTTTCCCG
AGAGCAACCAGTACTGGCTCTGAGCCTGAGCATGAAATCGGTGACGAAGAGGGCGTTGGGGTTGTCGATGAGGAG
GCAGAGAAACTGAGAGCTAGGGAAAGTGAATTCAAGAAGTTGGCAACACAATTCGAGGGCAGAAAGGAAGCAATT
AACGAAGTGATGTCCAAGCTCGATGACCTCTCTGATGCTCTGACAGAATTTCACCACCTACAAGCTCCGAAAATT
GAATTTCGAAGCACGTCGCGTAACAACTCAGCTGATCCCAGCTACGGCGAACAGCCTCAGACTCACGCCAGGTCA
CAGAGTGGTACTTCATCCTTCGTCAATACCAGCGATTCTAGCGTCCGGTCTCCTCCTGCACCTAAGCCTACTCCC
GCGTTTCACTTTCAACCAATGTCACACGTGCACACCGCTATATCAGCCGAACCTGATGCAGAACGTCAACTTCTT
ATCCCTTCCTTGGGCCGTAAAGAATCTATGGTTCTTCCTCTTATCATTGAGCCTGAATCTGATTCCCCGGGTCGC
ATGGTTGACAGTCCACTTTCTTCCGCTAGTCTGAAGTTACCATCTGAGAACAACCCTCAGTGA
Transcript >AgabiH97|003830
ATGGTTACTCTTCGGTACCTTGGATTATTTCTCTCCGTTGTTTCCGTTGCATCGCAGACCGTTAGGCTTGCGGGT
GATTCAACAATGGCGGTAGGAGGAGGCGGTAGCGGTACGCAAGGATGGGGCGTATTCCTGGCACAGTTCTTGACT
ATCCCCGTCGTCAACAATGCTATTGGGGGTGAAAGTGCTAGGTCATATAATGACCAAGGGTTATTCACAGATCTG
ATTGAAAACACTCAGAAGGGCGACTATGTCATAATCGAATTTGGTCACAATGATGGGAGTGCAGGCGCAATTGAC
AACGGAAAGCAGGATGCCGTCGGCGACGGCTACAATATAACAAGTGTTGTCACTACATCGAGTGGTTCCCAAATC
TTGATCCACAGCTTTGCCTTCTACATCGAAAATGCTATAACTGCTTTACTCCGGAAGGGTGCTATACCCATCATC
TCGTCACAGACCCCAGACAACATCTGGATCGACGGTGCCATTGCAGGCCCCAACAGGTTTGTAACTTACGCTCGG
AGCATTGGGTCTCGAAGAAATGTCACCTATGTCGACCATTATGCATACGTTGCTTCCGCCTTCAATACCCTCGGC
CAAATACAAACCACGACATTCTATCCGAATGATCATCTTCATACAAATGCTGCTGGCGCCCTTGTCGTAGCCGAA
GCCTTTCTGGACAAGCCGTTCCAGGAGAGTAGTGATGGGCTAAGCATGGCGAAGGCGACGATGCTCCGCAACGCC
TCTCGATGGCCGACATCGACATTGAGGTCCATGGACGATCGCAGCTCAACTCTCAGACCAGATGCCCGTTCAATA
GATGCCAATACTGCGCGATCGTCTCTTGACCGTCACTCTACAGCGAAACCGAGTGCAGGCGGCTTAGATCGACTG
AAGGAGGGCGCACTACCAACAAGGAGCTTGGTTGCTCTGAGCACACCTCATGACCAGGTTCTAGAGAGAATGTAC
AGCCATCCGCGCAGGTCTGAAAGTGCCCTTGCCCTTCCTTTTCCCAGCTCGCTGGATGCCAGGCACCCGCCACTC
CGTGTTCGATCTAAAACGGGTGGAAGTGAGATGGCTTCCACCCAAGCACGCATCGTAAATGAACCTGCGAATTCC
GGTGAAGGCCCTTTGGGTGCAACTCCTCCTGTCTCCTCTGCCAGCAACACCCTGCCAGCACCTACACTATACGAC
CCCTTCGACGGTTCTCCCCTTGGTACCGTCCTCCCACCAGAAGCCCCCACACACGAAGACGGCATGTCCGTACAT
ATAGAAGGATCCAACGAGGAATTATGGGCACACCTTTCGCGAGTGCTCGACCTTCAGAAACAGATCGCTCGGATG
CATGTCGACATGGAGGGTCTTGGCCAGGGAAAGCCGACGGATGGCAAGGGGAAAGGGGCCGCTTTCGCTTTCCCG
AGAGCAACCAGTACTGGCTCTGAGCCTGAGCATGAAATCGGTGACGAAGAGGGCGTTGGGGTTGTCGATGAGGAG
GCAGAGAAACTGAGAGCTAGGGAAAGTGAATTCAAGAAGTTGGCAACACAATTCGAGGGCAGAAAGGAAGCAATT
AACGAAGTGATGTCCAAGCTCGATGACCTCTCTGATGCTCTGACAGAATTTCACCACCTACAAGCTCCGAAAATT
GAATTTCGAAGCACGTCGCGTAACAACTCAGCTGATCCCAGCTACGGCGAACAGCCTCAGACTCACGCCAGGTCA
CAGAGTGGTACTTCATCCTTCGTCAATACCAGCGATTCTAGCGTCCGGTCTCCTCCTGCACCTAAGCCTACTCCC
GCGTTTCACTTTCAACCAATGTCACACGTGCACACCGCTATATCAGCCGAACCTGATGCAGAACGTCAACTTCTT
ATCCCTTCCTTGGGCCGTAAAGAATCTATGGTTCTTCCTCTTATCATTGAGCCTGAATCTGATTCCCCGGGTCGC
ATGGTTGACAGTCCACTTTCTTCCGCTAGTCTGAAGTTACCATCTGAGAACAACCCTCAGTGA
Gene >AgabiH97|003830
ATGGTTACTCTTCGGTACCTTGGATTATTTCTCTCCGTTGTTTCCGTTGCATCGCAGACCGTTAGGCTTGCGGGT
GATTCAACAATGGCGGTAGGAGGAGGCGGTAGCGGTACGCAAGGTGCGCATTACCGCATGTCAAATCTCTTTAGG
TGGATGTTTACCCTTGAAGTTAGGATGGGGCGTATTCCTGGCACAGTTCTTGACTATCCCCGTCGTCAACAATGC
TATTGGGGGTGAAAGTGCTAGGTCATATAATGACCAAGGGTTATTCACAGATCTGATTGAAAACACTCAGAAGGG
CGACTATGTCATAATCGAATTTGGTCACAATGATGGGAGTGCAGGCGCAATTGACAACGGAAAGCAGGATGCCGT
CGGCGACGGCTACAATATAACAAGTGTTGTCACTACATCGAGGCAAGTGGTTCAATACATGACGTTCATGCTGAG
ATTCACATATGATCACGTCAGTGGTTCCCAAATCTTGATCCACAGCTTTGCCTTCTACATCGAAAATGCTATAAC
TGCTTTACTCCGGAAGGGTGCTATACCCATCATCTCGTCACAGACCCCAGACAACATCTGGATCGACGGTGCCAT
TGCAGGCCCCAACAGGTTTGTAACTTACGCTCGGAGCATTGGGTCTCGAAGAAATGTCACCTATGTCGACCATTA
TGCATACGTTGCTTCCGCCTTCAATACCCTCGGCCAAATACAAACCACGACATTCTATCCGAATGATCATCTTCA
TACAAATGCTGCTGGCGCCCTTGTCGTAGCCGAAGCCTTTGTGCGCGGGTTGTTGTGTGGAAACAATTCCTTAAG
GTCAAGGGTCAATTCAGCTGGACAAGCCGTTCCAGGTACCACTTACCTTGTACTGAGTCTATATTTTGAGCTATC
TGACTCGCGTTACAGGAGAGTGTGTGTGATCAGCGTACTCGGTTGTATCGTAAAGTACTCGAATAGATACTCTCT
GAAGGTCCACGTGATAGAGTGATGGGCTAAGCATGGCGAAGGCGACGATGCTCCGCAACGCCTCTCGATGGCCGA
CATCGACATTGAGGTCCATGGACGATCGCAGCTCAACTCTCAGACCAGATGCCCGTTCAATAGATGCCAATACTG
CGCGATCGTCTCTTGACCGTCACTCTACAGCGAAACCGAGTGCAGGCGGCTTAGATCGACTGAAGGAGGGCGCAC
TACCAACAAGGAGCTTGGTTGCTCTGAGCACACCTCATGACCAGGTTCTAGAGAGAATGTACAGCCATCCGCGCA
GGTCTGAAAGTGCCCTTGCCCTTCCTTTTCCCAGCTCGCTGGATGCCAGGCACCCGCCACTCCGTGTTCGATCTA
AAACGGGTGGAAGTGAGATGGCTTCCACCCAAGCACGCATCGTAAATGAACCTGCGAATTCCGGTGAAGGCCCTT
TGGGTGCAACTCCTCCTGTCTCCTCTGCCAGCAACACCCTGCCAGCACCTACACTATACGACCCCTTCGACGGTT
CTCCCCTTGGTACCGTCCTCCCACCAGAAGCCCCCACACACGAAGACGGCATGTCCGTACATATAGAAGGATCCA
ACGAGGAATTATGGGCACACCTTTCGCGAGTGCTCGACCTTCAGAAACAGATCGCTCGGATGCATGTCGACATGG
AGGGTCTTGGCCAGGGAAAGCCGACGGATGGCAAGGGGAAAGGGGCCGCTTTCGCTTTCCCGAGAGCAACCAGTA
CTGGCTCTGAGCCTGAGCATGAAATCGGTGACGAAGAGGGCGTTGGGGTTGTCGATGAGGAGGCAGAGAAACTGA
GAGCTAGGGAAAGTGAATTCAAGAAGTTGGCAACACAATTCGAGGGCAGAAAGGAAGCAATTAACGAAGTGATGT
CCAAGGTCAATATTCCACTCATAACATTCAACTACATCTAACTAATAGCTCTTTCCAGCTCGATGACCTCTCTGA
TGCTCTGACAGAATTTCACCACCTACAAGCTCCGAAAATTGAATTTCGAAGCACGTCGCGTAACAACTCAGCTGA
TCCCAGCTACGGCGAACAGCCTCAGACTCACGCCAGGTCACAGAGTGGTACTTCATCCTTCGTCAATACCAGCGA
TTCTAGCGTCCGGTCTCCTCCTGCACCTAAGCCTACTCCCGCGTTTCACTTTCAACCAATGTCACACGTGCACAC
CGCTATATCAGCCGAACCTGATGCAGAACGTCAACTTCTTATCCCTTCCTTGGGCCGTAAAGAATCTATGGTTCT
TCCTCTTATCATTGAGCCTGAATCTGATTCCCCGGGTCGCATGGTTGACAGTCCACTTTCTTCCGCTAGTCTGAA
GTTACCATCTGAGAACAACCCTCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail