Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|003660
Gene name
Locationscaffold_1:912945..915306
Strand+
Gene length (bp)2361
Transcript length (bp)2253
Coding sequence length (bp)2253
Protein length (aa) 751

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01535 PPR PPR repeat 6.7E-01 346 374
PF01535 PPR PPR repeat 2.4E-01 602 627
PF01535 PPR PPR repeat 5.7E-02 673 693

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 313 698 2.0E-09
sp|P0C8A0|PP275_ARATH Pentatricopeptide repeat-containing protein At3g49730 OS=Arabidopsis thaliana GN=At3g49730 PE=2 SV=1 357 689 2.0E-09
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 227 708 6.0E-09
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 111 663 3.0E-08
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 343 707 9.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LFC5|PP360_ARATH Pentatricopeptide repeat-containing protein At5g01110 OS=Arabidopsis thaliana GN=At5g01110 PE=2 SV=1 313 698 2.0E-09
sp|P0C8A0|PP275_ARATH Pentatricopeptide repeat-containing protein At3g49730 OS=Arabidopsis thaliana GN=At3g49730 PE=2 SV=1 357 689 2.0E-09
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protein At5g64320, mitochondrial OS=Arabidopsis thaliana GN=At5g64320 PE=2 SV=1 227 708 6.0E-09
sp|Q9FJE6|PP437_ARATH Putative pentatricopeptide repeat-containing protein At5g59900 OS=Arabidopsis thaliana GN=At5g59900 PE=3 SV=1 111 663 3.0E-08
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa subsp. indica GN=Rf1 PE=2 SV=1 343 707 9.0E-07
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 335 708 1.0E-06
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 302 736 1.0E-06
sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protein At2g17140 OS=Arabidopsis thaliana GN=At2g17140 PE=2 SV=1 366 693 1.0E-06
sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 184 742 1.0E-06
sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=3 SV=2 343 693 2.0E-06
sp|Q9M907|PP217_ARATH Pentatricopeptide repeat-containing protein At3g06920 OS=Arabidopsis thaliana GN=At3g06920 PE=2 SV=1 266 685 2.0E-06
sp|Q9SR00|PP213_ARATH Pentatricopeptide repeat-containing protein At3g04760, chloroplastic OS=Arabidopsis thaliana GN=At3g04760 PE=2 SV=1 305 692 3.0E-06
sp|Q3E9F0|PP392_ARATH Pentatricopeptide repeat-containing protein At5g18475 OS=Arabidopsis thaliana GN=At5g18475 PE=2 SV=1 589 747 4.0E-06
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1 324 693 4.0E-06
sp|Q9SS81|PP221_ARATH Pentatricopeptide repeat-containing protein At3g09060 OS=Arabidopsis thaliana GN=At3g09060 PE=2 SV=1 470 692 6.0E-06
sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protein At1g13040, mitochondrial OS=Arabidopsis thaliana GN=At1g13040 PE=2 SV=1 374 708 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|003660
MGFALSFASLVVAHECSYAGHCSQPVAGLSLAAKPSPSPIFAFIRPRLVSTTDIHDICTHYANLVAKLKQAGKLG
SLPTRQILNETQLYRILWLLARSGRPPDVQMLYDILLDMPLVLGLTLTEDTHTAILRGLIYRGEIEVTRRWLERM
PKLPGHITPTLKHYHMFLKALPDMDVCTLRLMRSIVKNMRPVGCKPTYETYEIIWLNRWALYDRGDKVIRPHAAA
VLFDDMERDGLSYNPSFAEVLFQEYNKRGLPLYAEDARNMYEAKFLAYDTSASSAYGQMDIKLMRTAQSKGIRSA
ILLFKSWKPHRKPSPEQIRTLLRHSRQLADLRLVEQEFDVKCNVIHWSHLIVNNTRAGQLREALSIYDESKLAGI
IPDTYMTSPLIHFLCQSSFAPAQEASVNKALEIYRDLCSAIPSEENDTDHSAGLEQEIYSTLLRGLATVKYPYKY
IDVAKEIMNDMAARGITQDDSNTASSIIALHMRNASNTEEALDVYRRLKSPLDAKGYTVVLNVFCKLRFETTIQI
PSLKGYFEIVKDMRLAGFSTTVEVYTILLHRLSSTATEVQQNDKFPDAPSVIEALTRTLRRVHDLLSLDASLSPD
AVLWNQMISTYQRLGCFADAYRIWEMMYISGQFNDSSVSVILDACAFSGAYSIAKRIIERLMRDNYRFNMHNWST
WLECLCRLGKLDEAIQVLCGEIEGSPQGVTLNAEHVKLVYKFAKSENREGEVLHQIREKSPDLWATLPAHIQGLV
*
Coding >AgabiH97|003660
ATGGGATTCGCCTTGAGCTTTGCGTCTCTGGTGGTAGCGCATGAATGCTCATATGCAGGACATTGTTCACAGCCG
GTCGCAGGTCTCTCTCTCGCCGCCAAACCATCCCCATCACCCATCTTCGCCTTTATTCGGCCTCGACTCGTATCG
ACCACTGACATCCATGATATTTGTACCCACTACGCTAATCTCGTTGCAAAACTAAAACAAGCCGGAAAATTGGGC
AGCCTCCCAACGCGCCAGATTCTAAATGAGACACAGTTGTACAGAATTTTGTGGCTCCTCGCAAGATCTGGCCGG
CCGCCCGATGTTCAGATGCTCTATGACATTCTCCTGGATATGCCGCTCGTCCTCGGTTTGACGCTGACCGAGGAC
ACACACACTGCTATTCTCCGAGGTCTCATATATCGTGGAGAGATAGAAGTGACGCGCAGATGGCTTGAACGCATG
CCGAAGCTTCCTGGTCATATCACTCCGACACTCAAACACTATCATATGTTCCTAAAAGCCCTGCCAGACATGGAT
GTTTGTACACTCAGGCTCATGCGGAGCATAGTTAAAAATATGCGTCCGGTTGGATGCAAGCCAACCTACGAGACC
TACGAAATTATTTGGCTGAATCGATGGGCGCTATACGATCGAGGTGATAAAGTCATTCGGCCTCATGCTGCCGCC
GTGCTATTCGACGATATGGAACGCGATGGCTTGTCCTATAATCCGTCTTTTGCAGAGGTCTTGTTCCAGGAATAC
AATAAACGTGGTTTGCCTTTATATGCAGAGGATGCACGGAATATGTATGAGGCAAAGTTTCTCGCCTACGACACG
TCTGCATCTTCGGCATATGGACAGATGGACATAAAGCTTATGCGGACTGCCCAGTCCAAGGGCATCCGATCAGCT
ATTCTTCTTTTCAAGTCCTGGAAACCCCACAGGAAACCATCACCAGAGCAGATACGAACCCTGCTCCGCCACAGT
CGTCAGCTTGCGGACCTTCGCCTTGTTGAGCAAGAGTTTGATGTCAAATGCAATGTCATACACTGGTCCCACCTA
ATAGTGAATAATACCCGTGCTGGCCAACTTCGAGAAGCGCTCTCCATCTATGATGAATCGAAGTTGGCAGGGATC
ATTCCTGATACATACATGACCTCCCCCCTTATTCACTTTCTATGCCAGTCCAGCTTTGCTCCAGCTCAGGAGGCC
AGTGTAAACAAGGCTCTTGAGATATATCGAGACCTTTGCTCAGCAATTCCCTCTGAGGAAAATGATACCGACCAT
TCAGCCGGTCTTGAACAAGAAATCTACTCTACCCTTCTTCGCGGTCTCGCCACTGTCAAATATCCCTACAAATAC
ATAGACGTCGCAAAAGAGATCATGAACGACATGGCTGCTCGAGGGATCACACAAGACGACAGCAACACGGCGAGT
TCCATTATTGCCCTTCACATGCGCAACGCCTCGAACACAGAAGAGGCTCTGGACGTTTACCGACGTCTTAAATCA
CCACTGGATGCAAAGGGCTACACTGTCGTTTTGAACGTCTTCTGCAAATTGCGCTTTGAAACCACCATTCAAATT
CCCTCGCTAAAGGGGTATTTTGAGATTGTCAAGGATATGCGTTTGGCGGGGTTCAGCACCACCGTCGAGGTTTAT
ACTATCCTCCTTCATCGACTCAGCTCTACTGCCACCGAAGTTCAACAAAATGATAAATTCCCTGATGCGCCTTCA
GTCATCGAAGCCCTCACTCGCACCCTCCGCCGCGTGCATGATTTACTCAGTCTAGACGCCTCATTATCTCCGGAT
GCAGTGCTTTGGAATCAAATGATAAGCACGTACCAGCGTCTGGGATGTTTTGCCGATGCGTATCGGATTTGGGAG
ATGATGTACATTTCTGGCCAATTTAACGACTCTAGCGTCAGCGTCATCCTTGATGCATGTGCGTTCTCTGGAGCA
TATTCCATTGCGAAACGCATCATAGAGAGATTAATGAGGGACAACTACCGATTTAACATGCATAACTGGAGTACT
TGGCTGGAGTGTCTATGCAGACTGGGTAAACTCGACGAAGCGATCCAAGTCCTCTGTGGAGAAATTGAAGGTTCG
CCGCAAGGTGTAACACTAAATGCGGAGCATGTGAAGCTTGTATACAAGTTTGCCAAGTCTGAGAACAGGGAGGGA
GAGGTGCTTCATCAGATAAGGGAAAAATCCCCCGATCTTTGGGCCACTTTACCAGCACACATACAAGGACTCGTT
TAG
Transcript >AgabiH97|003660
ATGGGATTCGCCTTGAGCTTTGCGTCTCTGGTGGTAGCGCATGAATGCTCATATGCAGGACATTGTTCACAGCCG
GTCGCAGGTCTCTCTCTCGCCGCCAAACCATCCCCATCACCCATCTTCGCCTTTATTCGGCCTCGACTCGTATCG
ACCACTGACATCCATGATATTTGTACCCACTACGCTAATCTCGTTGCAAAACTAAAACAAGCCGGAAAATTGGGC
AGCCTCCCAACGCGCCAGATTCTAAATGAGACACAGTTGTACAGAATTTTGTGGCTCCTCGCAAGATCTGGCCGG
CCGCCCGATGTTCAGATGCTCTATGACATTCTCCTGGATATGCCGCTCGTCCTCGGTTTGACGCTGACCGAGGAC
ACACACACTGCTATTCTCCGAGGTCTCATATATCGTGGAGAGATAGAAGTGACGCGCAGATGGCTTGAACGCATG
CCGAAGCTTCCTGGTCATATCACTCCGACACTCAAACACTATCATATGTTCCTAAAAGCCCTGCCAGACATGGAT
GTTTGTACACTCAGGCTCATGCGGAGCATAGTTAAAAATATGCGTCCGGTTGGATGCAAGCCAACCTACGAGACC
TACGAAATTATTTGGCTGAATCGATGGGCGCTATACGATCGAGGTGATAAAGTCATTCGGCCTCATGCTGCCGCC
GTGCTATTCGACGATATGGAACGCGATGGCTTGTCCTATAATCCGTCTTTTGCAGAGGTCTTGTTCCAGGAATAC
AATAAACGTGGTTTGCCTTTATATGCAGAGGATGCACGGAATATGTATGAGGCAAAGTTTCTCGCCTACGACACG
TCTGCATCTTCGGCATATGGACAGATGGACATAAAGCTTATGCGGACTGCCCAGTCCAAGGGCATCCGATCAGCT
ATTCTTCTTTTCAAGTCCTGGAAACCCCACAGGAAACCATCACCAGAGCAGATACGAACCCTGCTCCGCCACAGT
CGTCAGCTTGCGGACCTTCGCCTTGTTGAGCAAGAGTTTGATGTCAAATGCAATGTCATACACTGGTCCCACCTA
ATAGTGAATAATACCCGTGCTGGCCAACTTCGAGAAGCGCTCTCCATCTATGATGAATCGAAGTTGGCAGGGATC
ATTCCTGATACATACATGACCTCCCCCCTTATTCACTTTCTATGCCAGTCCAGCTTTGCTCCAGCTCAGGAGGCC
AGTGTAAACAAGGCTCTTGAGATATATCGAGACCTTTGCTCAGCAATTCCCTCTGAGGAAAATGATACCGACCAT
TCAGCCGGTCTTGAACAAGAAATCTACTCTACCCTTCTTCGCGGTCTCGCCACTGTCAAATATCCCTACAAATAC
ATAGACGTCGCAAAAGAGATCATGAACGACATGGCTGCTCGAGGGATCACACAAGACGACAGCAACACGGCGAGT
TCCATTATTGCCCTTCACATGCGCAACGCCTCGAACACAGAAGAGGCTCTGGACGTTTACCGACGTCTTAAATCA
CCACTGGATGCAAAGGGCTACACTGTCGTTTTGAACGTCTTCTGCAAATTGCGCTTTGAAACCACCATTCAAATT
CCCTCGCTAAAGGGGTATTTTGAGATTGTCAAGGATATGCGTTTGGCGGGGTTCAGCACCACCGTCGAGGTTTAT
ACTATCCTCCTTCATCGACTCAGCTCTACTGCCACCGAAGTTCAACAAAATGATAAATTCCCTGATGCGCCTTCA
GTCATCGAAGCCCTCACTCGCACCCTCCGCCGCGTGCATGATTTACTCAGTCTAGACGCCTCATTATCTCCGGAT
GCAGTGCTTTGGAATCAAATGATAAGCACGTACCAGCGTCTGGGATGTTTTGCCGATGCGTATCGGATTTGGGAG
ATGATGTACATTTCTGGCCAATTTAACGACTCTAGCGTCAGCGTCATCCTTGATGCATGTGCGTTCTCTGGAGCA
TATTCCATTGCGAAACGCATCATAGAGAGATTAATGAGGGACAACTACCGATTTAACATGCATAACTGGAGTACT
TGGCTGGAGTGTCTATGCAGACTGGGTAAACTCGACGAAGCGATCCAAGTCCTCTGTGGAGAAATTGAAGGTTCG
CCGCAAGGTGTAACACTAAATGCGGAGCATGTGAAGCTTGTATACAAGTTTGCCAAGTCTGAGAACAGGGAGGGA
GAGGTGCTTCATCAGATAAGGGAAAAATCCCCCGATCTTTGGGCCACTTTACCAGCACACATACAAGGACTCGTT
TAG
Gene >AgabiH97|003660
ATGGGATTCGCCTTGAGCTTTGCGTCTCTGGTGGTATGTCGCGTTTTTTCTTTCCACCGGGCACGCCTCTCACTT
TGAACAGGTAGCGCATGAATGCTCATATGCAGGACATTGTTCACAGCCGGTCGCAGGTCTCTCTCTCGCCGCCAA
ACCATCCCCATCACCCATCTTCGCCTTTATTCGGCCTCGGTCAACCCTCCTAATGCCTCTGCATCAACTTCTTCC
TCCATAGACGACGATATCAAAAGACTCGTATCGACCACTGACATCCATGATATTTGTACCCACTACGCTAATCTC
GTTGCAAAACTAAAACAAGCCGGAAAATTGGGCAGCCTCCCAACGCGCCAGATTCTAAATGAGACACAGTTGTAC
AGAATTTTGTGGCTCCTCGCAAGATCTGGCCGGCCGCCCGATGTTCAGATGCTCTATGACATTCTCCTGGATATG
CCGCTCGTCCTCGGTTTGACGCTGACCGAGGACACACACACTGCTATTCTCCGAGGTCTCATATATCGTGGAGAG
ATAGAAGTGACGCGCAGATGGCTTGAACGCATGCCGAAGCTTCCTGGTCATATCACTCCGACACTCAAACACTAT
CATATGTTCCTAAAAGCCCTGCCAGACATGGATGTTTGTACACTCAGGCTCATGCGGAGCATAGTTAAAAATATG
CGTCCGGTTGGATGCAAGCCAACCTACGAGACCTACGAAATTATTTGGCTGAATCGATGGGCGCTATACGATCGA
GGTGATAAAGTCATTCGGCCTCATGCTGCCGCCGTGCTATTCGACGATATGGAACGCGATGGCTTGTCCTATAAT
CCGTCTTTTGCAGAGGTCTTGTTCCAGGAATACAATAAACGTGGTTTGCCTTTATATGCAGAGGATGCACGGAAT
ATGTATGAGGCAAAGTTTCTCGCCTACGACACGTCTGCATCTTCGGCATATGGACAGATGGACATAAAGCTTATG
CGGACTGCCCAGTCCAAGGGCATCCGATCAGCTATTCTTCTTTTCAAGTCCTGGAAACCCCACAGGAAACCATCA
CCAGAGCAGATACGAACCCTGCTCCGCCACAGTCGTCAGCTTGCGGACCTTCGCCTTGTTGAGCAAGAGTTTGAT
GTCAAATGCAATGTCATACACTGGTCCCACCTAATAGTGAATAATACCCGTGCTGGCCAACTTCGAGAAGCGCTC
TCCATCTATGATGAATCGAAGTTGGCAGGGATCATTCCTGATACATACATGACCTCCCCCCTTATTCACTTTCTA
TGCCAGTCCAGCTTTGCTCCAGCTCAGGAGGCCAGTGTAAACAAGGCTCTTGAGATATATCGAGACCTTTGCTCA
GCAATTCCCTCTGAGGAAAATGATACCGACCATTCAGCCGGTCTTGAACAAGAAATCTACTCTACCCTTCTTCGC
GGTCTCGCCACTGTCAAATATCCCTACAAATACATAGACGTCGCAAAAGAGATCATGAACGACATGGCTGCTCGA
GGGATCACACAAGACGACAGCAACACGGCGAGTTCCATTATTGCCCTTCACATGCGCAACGCCTCGAACACAGAA
GAGGCTCTGGACGTTTACCGACGTCTTAAATCACCACTGGATGCAAAGGGCTACACTGTCGTTTTGAACGTCTTC
TGCAAATTGCGCTTTGAAACCACCATTCAAATTCCCTCGCTAAAGGGGTATTTTGAGATTGTCAAGGATATGCGT
TTGGCGGGGTTCAGCACCACCGTCGAGGTTTATACTATCCTCCTTCATCGACTCAGCTCTACTGCCACCGAAGTT
CAACAAAATGATAAATTCCCTGATGCGCCTTCAGTCATCGAAGCCCTCACTCGCACCCTCCGCCGCGTGCATGAT
TTACTCAGTCTAGACGCCTCATTATCTCCGGATGCAGTGCTTTGGAATCAAATGATAAGCACGTACCAGCGTCTG
GGATGTTTTGCCGATGCGTATCGGATTTGGGAGATGATGTACATTTCTGGCCAATTTAACGACTCTAGCGTCAGC
GTCATCCTTGATGCATGTGCGTTCTCTGGAGCATATTCCATTGCGAAACGCATCATAGAGAGATTAATGAGGGAC
AACTACCGATTTAACATGCATAACTGGAGTACTTGGCTGGAGTGTCTATGCAGACTGGGTAAACTCGACGAAGCG
ATCCAAGTCCTCTGTGGAGAAATTGAAGGTTCGCCGCAAGGTGTAACACTAAATGCGGAGCATGTGAAGCTTGTA
TACAAGTTTGCCAAGTCTGAGAACAGGGAGGGAGAGGTGCTTCATCAGATAAGGGAAAAATCCCCCGATCTTTGG
GCCACTTTACCAGCACACATACAAGGACTCGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail