Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|003460
Gene name
Locationscaffold_1:868799..871138
Strand-
Gene length (bp)2339
Transcript length (bp)1788
Coding sequence length (bp)1788
Protein length (aa) 596

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06814 Lung_7-TM_R Lung seven transmembrane receptor 2.5E-64 192 497

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6ZZS6|PTM1_YEAS7 Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PTM1 PE=3 SV=1 7 570 1.0E-56
sp|P32857|PTM1_YEAST Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTM1 PE=1 SV=2 7 570 1.0E-56
sp|O13989|YEG7_SCHPO Uncharacterized protein C26H5.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.07c PE=3 SV=2 23 572 3.0E-52
sp|P38745|YHB7_YEAST Uncharacterized membrane protein YHL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL017W PE=1 SV=1 190 570 1.0E-45
sp|Q8BKU8|TM87B_MOUSE Transmembrane protein 87B OS=Mus musculus GN=Tmem87b PE=2 SV=1 193 562 4.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6ZZS6|PTM1_YEAS7 Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PTM1 PE=3 SV=1 7 570 1.0E-56
sp|P32857|PTM1_YEAST Membrane protein PTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTM1 PE=1 SV=2 7 570 1.0E-56
sp|O13989|YEG7_SCHPO Uncharacterized protein C26H5.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.07c PE=3 SV=2 23 572 3.0E-52
sp|P38745|YHB7_YEAST Uncharacterized membrane protein YHL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL017W PE=1 SV=1 190 570 1.0E-45
sp|Q8BKU8|TM87B_MOUSE Transmembrane protein 87B OS=Mus musculus GN=Tmem87b PE=2 SV=1 193 562 4.0E-27
sp|Q96K49|TM87B_HUMAN Transmembrane protein 87B OS=Homo sapiens GN=TMEM87B PE=1 SV=1 193 562 1.0E-25
sp|Q28EW0|TM87A_XENTR Transmembrane protein 87A OS=Xenopus tropicalis GN=tmem87a PE=2 SV=1 236 515 4.0E-24
sp|Q8BXN9|TM87A_MOUSE Transmembrane protein 87A OS=Mus musculus GN=Tmem87a PE=1 SV=1 193 562 2.0E-22
sp|Q8NBN3|TM87A_HUMAN Transmembrane protein 87A OS=Homo sapiens GN=TMEM87A PE=1 SV=3 242 502 3.0E-21
sp|Q9Y7Y9|YOD2_SCHPO Uncharacterized membrane protein C18A7.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18A7.02c PE=3 SV=1 5 499 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 246 268 22
2 280 302 22
3 312 343 31
4 356 373 17
5 383 405 22
6 431 453 22
7 468 490 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|003460
MFSSLIFLLSLIFYAIAFQVPFTDSDYSRQTCSGMWAGRNTYINVTFGQGSLGQVAMVIYEWADAPFLGKVDAGH
DDDLRVPKTYVCTSDALARGDCTRDQLGRFILDLPQGKPINDTSFWSARVLLSSGAGDPVSTLTTRGINLESLDH
ERRLPIPRIEAPWRRDAHVSRENPNPSPGGILSYQAPIHYLVQRTGYYCVAILPVSTSSQNPRADTDVPYHPSYV
GTVLFRNTFDGQLEAIDYPKVNFYFAMSVIYVIFGLAWGWLCWRNSQDLLPLQNYLSGLVGLLVIEMVGNWAYYR
YLNAHGRSTASTIFLIVVSILDAGKASMSFFMLLVVAMGLSVVKESLGRNMFRCQLLACAHFVFGILYSVGIVEL
SLESTSALVLLLFIIPLAFTLSGFLLWIMYSLNTTITYLRERKQRYKLKMFRRLHYILMFVVCTITAFFVVSSFA
FSGRLAEDFEAKQWKIRWWLLDGWLALLYLVSFAAIAFLWRPSANNRRLAMSDEIAQDENDAEDYDLETLHHRQR
LRDDDDDDATLVGTRGGHIPSVVEDHVVFEIGDEDDEDEDSAKKRHPERLSGENLHHSGEREGLMTARND*
Coding >AgabiH97|003460
ATGTTTTCTTCTTTGATTTTTCTTCTCTCCTTAATCTTCTATGCTATTGCTTTCCAAGTTCCATTCACAGATTCA
GATTATTCCAGACAAACATGCAGTGGCATGTGGGCAGGGCGCAATACATATATCAATGTTACATTTGGTCAAGGC
TCGCTGGGTCAGGTTGCCATGGTCATCTATGAGTGGGCCGACGCACCATTTCTGGGCAAGGTTGACGCAGGTCAT
GATGACGATCTCCGCGTACCTAAAACTTATGTCTGTACCTCTGATGCACTTGCTCGAGGCGACTGCACGCGAGAC
CAGCTTGGACGTTTCATTCTCGACCTCCCTCAAGGCAAACCGATCAATGACACCAGCTTTTGGTCCGCGCGCGTC
CTCTTATCATCAGGCGCTGGGGACCCAGTTTCTACCTTGACTACCAGGGGGATCAACCTGGAGTCTCTTGATCAT
GAGCGACGCTTACCCATACCAAGAATTGAGGCTCCCTGGCGGCGAGATGCGCATGTGAGCAGAGAGAACCCGAAT
CCTAGTCCGGGTGGAATTTTATCGTATCAAGCCCCGATTCATTACCTTGTCCAAAGGACGGGCTATTACTGTGTT
GCCATATTACCTGTCTCAACCAGCTCTCAAAACCCTCGTGCAGATACGGATGTTCCATATCATCCTAGCTATGTT
GGCACCGTATTGTTCAGAAACACATTCGATGGCCAATTGGAGGCCATAGATTATCCCAAAGTTAATTTTTATTTT
GCTATGTCAGTGATATATGTTATTTTCGGTCTTGCCTGGGGTTGGTTGTGCTGGAGGAATTCCCAAGATCTATTA
CCGTTGCAAAATTACCTTTCAGGCCTCGTTGGTCTCCTCGTAATCGAGATGGTAGGAAATTGGGCCTATTACCGC
TACCTTAACGCCCATGGCAGAAGTACGGCCTCAACAATCTTTCTCATCGTCGTATCAATTCTTGATGCCGGAAAA
GCATCCATGTCATTCTTTATGCTACTCGTCGTTGCGATGGGTTTAAGTGTGGTAAAGGAGTCTTTGGGCAGGAAC
ATGTTCAGATGCCAGCTCTTAGCTTGTGCTCATTTCGTTTTTGGCATATTGTATTCTGTCGGCATCGTGGAATTG
TCACTCGAATCGACGTCCGCACTGGTGCTCCTCTTGTTCATCATTCCTTTAGCATTCACTTTAAGCGGATTCCTT
CTTTGGATCATGTATTCCTTGAATACTACCATTACCTATCTCCGTGAACGAAAGCAACGCTATAAACTAAAGATG
TTTAGGCGCCTGCACTATATCCTTATGTTTGTTGTCTGCACTATCACTGCCTTCTTTGTCGTCTCCTCCTTTGCA
TTCTCCGGTCGCTTAGCCGAAGACTTCGAAGCCAAACAATGGAAAATTCGATGGTGGCTCCTTGACGGTTGGCTT
GCCTTGTTATACCTCGTCTCTTTTGCTGCTATCGCGTTTCTGTGGCGCCCATCAGCAAACAATAGGCGTTTGGCT
ATGTCTGATGAAATCGCTCAGGATGAGAATGATGCCGAAGATTATGATCTCGAGACTCTCCATCATCGTCAACGA
CTGAGGGATGACGATGATGATGACGCTACTCTTGTCGGCACCCGCGGCGGTCATATTCCGTCAGTAGTAGAAGAC
CACGTTGTGTTTGAGATTGGAGACGAAGATGACGAGGACGAGGATTCTGCCAAAAAGCGCCACCCTGAACGCCTT
TCAGGAGAGAATCTGCACCATTCAGGAGAACGGGAAGGTCTTATGACCGCGAGAAACGATTGA
Transcript >AgabiH97|003460
ATGTTTTCTTCTTTGATTTTTCTTCTCTCCTTAATCTTCTATGCTATTGCTTTCCAAGTTCCATTCACAGATTCA
GATTATTCCAGACAAACATGCAGTGGCATGTGGGCAGGGCGCAATACATATATCAATGTTACATTTGGTCAAGGC
TCGCTGGGTCAGGTTGCCATGGTCATCTATGAGTGGGCCGACGCACCATTTCTGGGCAAGGTTGACGCAGGTCAT
GATGACGATCTCCGCGTACCTAAAACTTATGTCTGTACCTCTGATGCACTTGCTCGAGGCGACTGCACGCGAGAC
CAGCTTGGACGTTTCATTCTCGACCTCCCTCAAGGCAAACCGATCAATGACACCAGCTTTTGGTCCGCGCGCGTC
CTCTTATCATCAGGCGCTGGGGACCCAGTTTCTACCTTGACTACCAGGGGGATCAACCTGGAGTCTCTTGATCAT
GAGCGACGCTTACCCATACCAAGAATTGAGGCTCCCTGGCGGCGAGATGCGCATGTGAGCAGAGAGAACCCGAAT
CCTAGTCCGGGTGGAATTTTATCGTATCAAGCCCCGATTCATTACCTTGTCCAAAGGACGGGCTATTACTGTGTT
GCCATATTACCTGTCTCAACCAGCTCTCAAAACCCTCGTGCAGATACGGATGTTCCATATCATCCTAGCTATGTT
GGCACCGTATTGTTCAGAAACACATTCGATGGCCAATTGGAGGCCATAGATTATCCCAAAGTTAATTTTTATTTT
GCTATGTCAGTGATATATGTTATTTTCGGTCTTGCCTGGGGTTGGTTGTGCTGGAGGAATTCCCAAGATCTATTA
CCGTTGCAAAATTACCTTTCAGGCCTCGTTGGTCTCCTCGTAATCGAGATGGTAGGAAATTGGGCCTATTACCGC
TACCTTAACGCCCATGGCAGAAGTACGGCCTCAACAATCTTTCTCATCGTCGTATCAATTCTTGATGCCGGAAAA
GCATCCATGTCATTCTTTATGCTACTCGTCGTTGCGATGGGTTTAAGTGTGGTAAAGGAGTCTTTGGGCAGGAAC
ATGTTCAGATGCCAGCTCTTAGCTTGTGCTCATTTCGTTTTTGGCATATTGTATTCTGTCGGCATCGTGGAATTG
TCACTCGAATCGACGTCCGCACTGGTGCTCCTCTTGTTCATCATTCCTTTAGCATTCACTTTAAGCGGATTCCTT
CTTTGGATCATGTATTCCTTGAATACTACCATTACCTATCTCCGTGAACGAAAGCAACGCTATAAACTAAAGATG
TTTAGGCGCCTGCACTATATCCTTATGTTTGTTGTCTGCACTATCACTGCCTTCTTTGTCGTCTCCTCCTTTGCA
TTCTCCGGTCGCTTAGCCGAAGACTTCGAAGCCAAACAATGGAAAATTCGATGGTGGCTCCTTGACGGTTGGCTT
GCCTTGTTATACCTCGTCTCTTTTGCTGCTATCGCGTTTCTGTGGCGCCCATCAGCAAACAATAGGCGTTTGGCT
ATGTCTGATGAAATCGCTCAGGATGAGAATGATGCCGAAGATTATGATCTCGAGACTCTCCATCATCGTCAACGA
CTGAGGGATGACGATGATGATGACGCTACTCTTGTCGGCACCCGCGGCGGTCATATTCCGTCAGTAGTAGAAGAC
CACGTTGTGTTTGAGATTGGAGACGAAGATGACGAGGACGAGGATTCTGCCAAAAAGCGCCACCCTGAACGCCTT
TCAGGAGAGAATCTGCACCATTCAGGAGAACGGGAAGGTCTTATGACCGCGAGAAACGATTGA
Gene >AgabiH97|003460
ATGTTTTCTTCTTTGATTTTTCTTCTCTCCTTAATCTTCTATGCTATTGCTTTCCAAGTTCCATTCACAGATTCA
GGTATGTTCTCATTTTTGTGGCGTTCTATTATGTCTCATTTCTCTGCCAGATTATTCCAGACAAACATGCAGTGG
CATGTGGGCAGGGCGCAATACATATATCAATGGTGCGCGATATGCTACAACTTTCTCTTCTATCTCTAATATCCA
CTGTCAGTTACATTTGGTCAAGGCTCGCTGGGTCAGGTTGCCATGGTCATCTATGAGTGGGCCGACGCACCATTT
CTGGGCAAGGTTGACGCAGGTCATGATGACGATCTCCGCGTACCTGTAAGAGAAACCGCTTCCTGATTTCATTTT
TAAACTTATCGTCATAGAAAACTTATGTCTGTACCTCTGATGCACTTGCTCGAGGCGACTGCACGCGAGACCAGC
TTGGACGTTTCATTCTCGACCTCCCTCAAGGCAAACCGATCAATGACACCAGCTTTTGGTCCGCGCGCGTCCTCT
TATCATCAGGCGCTGGGGACCCAGTTTCTACCTTGACTACCAGGGGGATCAACCTGGAGTCTCTTGATCATGAGC
GACGCTTACCCATACCAAGAATTGAGGCTCCCTGGCGGCGAGATGCGCATGTGAGCAGAGAGAACCCGAATCCTA
GTCCGGGTGGAATTTTATCGTATCAAGCCCCGATTCATTACCTTGTCCAAAGGACGGGCTATTACTGTGTTGGTG
TGTACATTGGTATCTCTGCCTCTTCTAGCTCAAATCATCTATGCAGCCATATTACCTGTCTCAACCAGCTCTCAA
AACCCTCGTGCAGATACGGATGTTCCATATCATCCTAGCTATGTTGGCACCGTATTGTTCAGAAACACATTCGAT
GGCCAATTGGAGGCCATAGATTATCCCAAAGTTAATGTATATACTCCTATCATCGCCCTACCCAGGACGCGAGTC
TAACCGTCGTTAAGTTTTATTTTGCTATGTCAGTGATATATGTTATTTTCGGTCTTGCCTGGGGTTGGTTGTGCT
GGAGGAATTCCCAAGATCTATTACCGTTGCAAGTGAGTTCGATTTAGTTCACCGAGATGGGCTAAATTTCATTTG
GCCTAGAATTACCTTTCAGGCCTCGTTGGTCTCCTCGTAATCGAGATGGTAGGAAATTGGGGTACGTGATTGTTT
GCATATATCATTCTGCGGTTAATCATTGTATATCTAGCCTATTACCGCTACCTTAACGCCCATGGCAGAAGTACG
GCCTCAACAATCTTTCTCATCGTCGGTAAGTGAAACGTCCTATCTTTTCACCCAGAAACTTTTGGCTCATGATCA
ACAGTATCAATTCTTGATGCCGGAAAAGCATCCATGTCATTCTTTATGCTACTCGTCGTTGCGATGGGTTTAAGT
GTGGTAAAGGAGTCTTTGGGCAGGAACATGTTCAGATGCCAGCTCTTAGCTTGTGCTCATTTCGTTTTTGGCAGT
AAGTGTCTATTCAAGGACCGTTAACTGCGTTTTTACATTTTCACAGTATTGTATTCTGTCGGCATCGTGGAATTG
TCACTCGAATCGACGTCCGCACTGGTGCTCCTCTTGTTCATCATTCCTTTAGCATTCACTTTAAGCGGATTCCTT
CTTTGGATCATGTATTCCTTGAATAGTACGTTTAAATTTCCACATACTGTATCTGGACGTTGACTGACCTGGTAT
AGCTACCATTACCTATCTCCGTGAACGAAAGCAACGCTATAAACTAAAGATGTTTAGGCGCCTGCACTATATCCT
TATGTTTGTTGTCTGCACTATCACTGCCTTCTTTGTCGTCTCCTCCTTTGCATTCTCCGGTCGCTTAGCCGAAGG
TAGGAAATTATTGTTTTATTTAGATTTGACGTTGATATCCCCGTTTAGACTTCGAAGCCAAACAATGGAAAATTC
GATGGTGGCTCCTTGACGGTTGGCTTGCCTTGTTATACCTCGTCTCTTTTGCTGCTATCGCGTTTCTGTGGCGCC
CATCAGCAAACAATAGGCGTTTGGCTATGTCTGATGAAATCGCTCAGGATGAGAATGATGCCGAAGATTATGATC
TCGAGACTCTCCATCATCGTCAACGACTGAGGGATGACGATGATGATGACGCTACTCTTGTCGGCACCCGCGGCG
GTCATATTCCGTCAGTAGTAGAAGACCACGTTGTGTTTGAGATTGGAGACGAAGATGACGAGGACGAGGATTCTG
CCAAAAAGCGCCACCCTGAACGCCTTTCAGGAGAGAATCTGCACCATTCAGGAGAACGGGAAGGTCTTATGACCG
CGAGAAACGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail