Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|003400
Gene name
Locationscaffold_1:857527..858720
Strand+
Gene length (bp)1193
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 2.4E-10 5 202
PF01370 Epimerase NAD dependent epimerase/dehydratase family 7.4E-10 6 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q559Z0|NDUA9_DICDI NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Dictyostelium discoideum GN=ndufa9 PE=3 SV=1 61 240 8.0E-24
sp|Q9SK66|NDUA9_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Arabidopsis thaliana GN=At2g20360 PE=1 SV=2 6 301 2.0E-22
sp|P34943|NDUA9_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Bos taurus GN=NDUFA9 PE=1 SV=1 69 285 1.0E-18
sp|Q5BK63|NDUA9_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Rattus norvegicus GN=Ndufa9 PE=1 SV=2 64 290 2.0E-16
sp|Q9DC69|NDUA9_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Mus musculus GN=Ndufa9 PE=1 SV=2 64 287 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q559Z0|NDUA9_DICDI NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Dictyostelium discoideum GN=ndufa9 PE=3 SV=1 61 240 8.0E-24
sp|Q9SK66|NDUA9_ARATH NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Arabidopsis thaliana GN=At2g20360 PE=1 SV=2 6 301 2.0E-22
sp|P34943|NDUA9_BOVIN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Bos taurus GN=NDUFA9 PE=1 SV=1 69 285 1.0E-18
sp|Q5BK63|NDUA9_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Rattus norvegicus GN=Ndufa9 PE=1 SV=2 64 290 2.0E-16
sp|Q9DC69|NDUA9_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Mus musculus GN=Ndufa9 PE=1 SV=2 64 287 2.0E-14
sp|Q0MQB4|NDUA9_PANTR NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Pan troglodytes GN=NDUFA9 PE=2 SV=1 64 244 2.0E-14
sp|Q0MQB3|NDUA9_GORGO NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFA9 PE=2 SV=2 64 244 3.0E-14
sp|P0CB82|NDUA9_PONPY NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Pongo pygmaeus GN=NDUFA9 PE=2 SV=1 64 244 4.0E-14
sp|P0CB81|NDUA9_PONAB NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Pongo abelii GN=NDUFA9 PE=2 SV=1 64 244 4.0E-14
sp|Q16795|NDUA9_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial OS=Homo sapiens GN=NDUFA9 PE=1 SV=2 64 244 5.0E-14
sp|P25284|NDUA9_NEUCR NADH-ubiquinone oxidoreductase 40 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo40 PE=1 SV=2 61 252 6.0E-14
sp|P75822|YBJT_ECOLI Uncharacterized protein YbjT OS=Escherichia coli (strain K12) GN=ybjT PE=4 SV=2 1 284 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:1901576 organic substance biosynthetic process No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0009058 biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0016229 steroid dehydrogenase activity No
GO:0008202 steroid metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No
GO:0006629 lipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|003400
MPLKIVVCGAGFLGSNIARQIATAPKVNDITRRVQLSSRNPHRLHAKLEKEVPSHSLSPSIAVDVTKPNTLAPAF
EGAKVIVSLVGLMHGSPQQFDEIQWHGAENVAYAAKQVGAKLVHFSAIGADAGSHIPYARTKGLAEKSVLEICPN
ATIIRPSLVFGPEDDFFNRFAKLARFLPFLPVYGGGTSRFQPVYVGDLARAVEIISRLDATIEKQVSGKITEAGG
PDIFTFKQLMELVLDYSHRRRPIISFPFAFGYMQGAILEKLPVNLFTVTRAQVEQLRKDNIVTEENGESRFSFKN
LIAEGYHPPLRSLVEILPQYLQ*
Coding >AgabiH97|003400
ATGCCCTTGAAAATCGTTGTATGCGGCGCAGGCTTCTTGGGTTCTAACATTGCTCGGCAAATCGCCACCGCTCCG
AAAGTGAACGACATAACGCGTCGCGTACAACTTTCCTCTCGTAACCCCCATCGTCTTCATGCCAAACTTGAGAAA
GAGGTTCCGAGCCACTCTCTTTCTCCATCAATCGCAGTGGACGTGACTAAACCTAATACTCTTGCGCCCGCCTTT
GAAGGTGCTAAAGTTATAGTATCGCTCGTTGGTTTAATGCACGGCTCTCCACAGCAATTTGATGAAATCCAGTGG
CACGGAGCAGAAAATGTCGCATATGCCGCAAAACAAGTAGGAGCGAAACTGGTGCATTTCAGTGCAATAGGTGCA
GACGCTGGTAGCCATATACCATACGCGAGGACCAAGGGGCTAGCAGAAAAGTCGGTACTGGAAATCTGTCCAAAT
GCGACGATTATCAGACCAAGCTTGGTATTCGGGCCAGAAGATGACTTCTTCAATAGGTTTGCGAAGCTTGCCAGA
TTTTTGCCTTTCTTACCGGTGTATGGTGGGGGAACTTCACGATTTCAACCGGTGTACGTTGGCGACCTGGCCCGC
GCAGTTGAAATCATTTCGAGGTTGGATGCGACGATTGAGAAACAGGTCTCTGGAAAGATAACCGAAGCAGGCGGT
CCCGATATCTTCACATTCAAGCAGCTCATGGAGCTTGTCCTCGATTACTCGCATCGTCGCCGACCTATCATATCC
TTTCCTTTTGCATTCGGATACATGCAGGGCGCCATTTTGGAAAAGCTTCCCGTCAACCTTTTCACGGTGACTCGG
GCCCAGGTTGAACAGCTCAGGAAGGACAACATCGTCACTGAGGAAAATGGCGAAAGCAGATTTTCCTTCAAAAAC
TTGATAGCGGAAGGATATCATCCACCTTTGAGGTCTTTGGTAGAAATCTTGCCTCAGTACTTACAATAG
Transcript >AgabiH97|003400
ATGCCCTTGAAAATCGTTGTATGCGGCGCAGGCTTCTTGGGTTCTAACATTGCTCGGCAAATCGCCACCGCTCCG
AAAGTGAACGACATAACGCGTCGCGTACAACTTTCCTCTCGTAACCCCCATCGTCTTCATGCCAAACTTGAGAAA
GAGGTTCCGAGCCACTCTCTTTCTCCATCAATCGCAGTGGACGTGACTAAACCTAATACTCTTGCGCCCGCCTTT
GAAGGTGCTAAAGTTATAGTATCGCTCGTTGGTTTAATGCACGGCTCTCCACAGCAATTTGATGAAATCCAGTGG
CACGGAGCAGAAAATGTCGCATATGCCGCAAAACAAGTAGGAGCGAAACTGGTGCATTTCAGTGCAATAGGTGCA
GACGCTGGTAGCCATATACCATACGCGAGGACCAAGGGGCTAGCAGAAAAGTCGGTACTGGAAATCTGTCCAAAT
GCGACGATTATCAGACCAAGCTTGGTATTCGGGCCAGAAGATGACTTCTTCAATAGGTTTGCGAAGCTTGCCAGA
TTTTTGCCTTTCTTACCGGTGTATGGTGGGGGAACTTCACGATTTCAACCGGTGTACGTTGGCGACCTGGCCCGC
GCAGTTGAAATCATTTCGAGGTTGGATGCGACGATTGAGAAACAGGTCTCTGGAAAGATAACCGAAGCAGGCGGT
CCCGATATCTTCACATTCAAGCAGCTCATGGAGCTTGTCCTCGATTACTCGCATCGTCGCCGACCTATCATATCC
TTTCCTTTTGCATTCGGATACATGCAGGGCGCCATTTTGGAAAAGCTTCCCGTCAACCTTTTCACGGTGACTCGG
GCCCAGGTTGAACAGCTCAGGAAGGACAACATCGTCACTGAGGAAAATGGCGAAAGCAGATTTTCCTTCAAAAAC
TTGATAGCGGAAGGATATCATCCACCTTTGAGGTCTTTGGTAGAAATCTTGCCTCAGTACTTACAATAG
Gene >AgabiH97|003400
ATGCCCTTGAAAATCGTTGTATGCGGCGCAGGCTTCTTGGGTGAGTTATCTTCCTCATTCTCCGGTTAGGTCTGA
CCCAGAGGAATTTGGAGGTTCTAACATTGCTCGGCAAATCGCCACCGCTCCGAAAGTGAACGACATAACGCGTCG
CGTACAACTTTCCTCTCGTAACCCCCATCGTCTTCATGCCAAACTTGAGAAAGAGGTTCCGAGCCACTCTCTTTC
TCCATCAATCGCAGTGGACGTGACTAAACCTAATACTCTTGCGCCCGCCTTTGAAGGTGCTAAAGTTATAGTATC
GCTCGTTGGTTTAATGCACGGCTCTCCACAGCAATTTGATGAAATCCAGTGGCACGGAGCAGAAAATGTCGCATA
TGCCGCAAAACAAGTAGGAGCGAAACTGGTGCATTTCAGTGCAATAGGTGCAGACGCTGGTAGCCATATACCATA
CGCGAGGACCAAGGGGCTAGCAGAAAAGTCGGTACTGGAAATCTGTCCAAATGCGACGATTATCAGACCAAGCTT
GGTATTCGGGCCAGAAGATGACTTCTTCAATGTGAATCAGCTCCACTTCCGCTTTGTCACTTACGCATATCCATT
TGATAGAGGTTTGCGAAGCTTGCCAGATTTTTGCCTTTCTTACCGGTGTATGGTGGGGGAACTTCACGATTTCAA
CCGGTGTACGTTGGCGACCTGGCCCGCGCAGTTGAAATCATTTCGAGGTTGGATGCGACGATTGAGAAACAGGTC
TCTGGAAAGATAACCGAAGCAGGCGGTCCCGATAGTAAGCACTTTTCCATGAGTCATACTCATGCAGATATTAGT
GTTAACGGTACCTGGGAATAGTCTTCACATTCAAGCAGCTCATGGAGCTTGTCCTCGATTACTCGCATCGTCGCC
GACCTATCATATCCTTTCCTTTTGCATTCGGATACATGCAGGGCGCCATTTTGGAAAAGCTTCCCGTCAACCTTT
TCACGGTGACTCGGGCCCAGGTGAGAAGTCCATCAGTTCTGATGCATTGTCATATTGATATTGAGTTATGGCATG
TTAAGGTTGAACAGCTCAGGAAGGACAACATCGTCACTGAGGAAAATGGCGAAAGCAGATTTTCCTTCAAAAACT
TGATAGCGGAAGGATATCATCCACCTTTGAGGTCTTTGGTAGAAATCTTGCCTCAGTACTTACAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail