Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|003310
Gene name
Locationscaffold_1:833545..834749
Strand-
Gene length (bp)1204
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00445 Ribonuclease_T2 Ribonuclease T2 family 2.0E-43 64 265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10281|RNT2_ASPOR Ribonuclease T2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rntB PE=1 SV=2 45 302 2.0E-51
sp|P24657|RNTR_HYPRU Ribonuclease Trv OS=Hypocrea rufa PE=1 SV=1 45 280 3.0E-48
sp|Q6BHB1|RNY1_DEBHA Ribonuclease T2-like OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RNY1 PE=3 SV=2 45 287 2.0E-43
sp|P19791|RNM_ASPPH Ribonuclease M OS=Aspergillus phoenicis PE=1 SV=1 40 291 2.0E-43
sp|Q5AK94|RNY1A_CANAL Ribonuclease T2-like 1-A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RNY1-A PE=3 SV=1 45 291 1.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10281|RNT2_ASPOR Ribonuclease T2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rntB PE=1 SV=2 45 302 2.0E-51
sp|P24657|RNTR_HYPRU Ribonuclease Trv OS=Hypocrea rufa PE=1 SV=1 45 280 3.0E-48
sp|Q6BHB1|RNY1_DEBHA Ribonuclease T2-like OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RNY1 PE=3 SV=2 45 287 2.0E-43
sp|P19791|RNM_ASPPH Ribonuclease M OS=Aspergillus phoenicis PE=1 SV=1 40 291 2.0E-43
sp|Q5AK94|RNY1A_CANAL Ribonuclease T2-like 1-A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RNY1-A PE=3 SV=1 45 291 1.0E-42
sp|Q5B3K6|RNY1_EMENI Ribonuclease T2-like OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rny1 PE=3 SV=1 5 303 4.0E-41
sp|Q4WXZ5|RNY1_ASPFU Ribonuclease T2-like OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rny1 PE=3 SV=2 45 275 2.0E-40
sp|P81296|RNL2_LENED Ribonuclease Le2 OS=Lentinula edodes PE=1 SV=1 50 294 1.0E-39
sp|Q02933|RNY1_YEAST Ribonuclease T2-like OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNY1 PE=1 SV=1 45 291 3.0E-39
sp|Q6CAV7|RNY1_YARLI Ribonuclease T2-like OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RNY1 PE=3 SV=1 46 287 8.0E-39
sp|Q5AKB1|RNY1B_CANAL Ribonuclease T2-like 1-B OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RNY1-B PE=3 SV=1 55 291 1.0E-36
sp|Q6FP42|RNY1_CANGA Ribonuclease T2-like OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RNY1 PE=3 SV=1 45 298 2.0E-33
sp|Q6CRT6|RNY1_KLULA Ribonuclease T2-like OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RNY1 PE=3 SV=1 46 295 2.0E-30
sp|P08056|RNRH_RHINI Ribonuclease Rh OS=Rhizopus niveus PE=1 SV=1 45 295 6.0E-25
sp|Q75BW5|RNY1_ASHGO Ribonuclease T2-like OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RNY1 PE=3 SV=1 46 300 1.0E-23
sp|Q7M438|RNDI_DICDI Ribonuclease DdI OS=Dictyostelium discoideum GN=ddiA PE=1 SV=3 83 252 1.0E-18
sp|P42813|RNS1_ARATH Ribonuclease 1 OS=Arabidopsis thaliana GN=RNS1 PE=1 SV=1 86 262 6.0E-10
sp|Q7M329|RNT2_PIG Ribonuclease T2 OS=Sus scrofa GN=RNASET2 PE=1 SV=1 86 251 2.0E-08
sp|B8XY56|RNT2_DANRE Ribonuclease T2 OS=Danio rerio GN=rnaset2 PE=2 SV=1 65 255 5.0E-08
sp|Q7M456|RNOY_CRAGI Ribonuclease Oy OS=Crassostrea gigas PE=1 SV=1 70 295 2.0E-07
sp|P81477|PHYB_PHYPO Ribonuclease Phyb OS=Physarum polycephalum PE=1 SV=1 91 251 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0033897 ribonuclease T2 activity Yes
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0004518 nuclease activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0004521 endoribonuclease activity No
GO:0004519 endonuclease activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0097159 organic cyclic compound binding No
GO:0016849 phosphorus-oxygen lyase activity No
GO:0004540 ribonuclease activity No
GO:0005488 binding No
GO:0016829 lyase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|003310
MKAQSTASFLFLVTSSFASSVLGNCDQSPQFYPNLAKCISEQSFFSCENTTTIENTCCSPTPGGLVLSTQFWSTY
TGLENRGQKLPKDSWTLHGLWPDNCDGSFEQYCDFSRQFDPAPDPAVLPNGVPVPVYKGPGVDVFIKQFGKNKLL
DYMNTYWIAQGTPNADFWAHEFSKHATCTSTFDVACYGEDYQKHVEVIDFFETAIRFFQNFPTFKLLAAANIVPS
NKTMYKLDDLEAAVISQLGAVPYFGCTHNGTVLSEVWYFTHVFGTEQFGSIKTIESVTPSSCNRSGDIWYYERTA
DSERDVEF*
Coding >AgabiH97|003310
ATGAAGGCGCAAAGCACTGCATCCTTTTTGTTCCTGGTCACAAGTTCTTTCGCCAGCTCTGTCCTCGGGAACTGC
GATCAAAGCCCCCAGTTCTATCCTAATCTCGCCAAGTGCATCAGCGAGCAATCTTTTTTCTCCTGCGAGAATACC
ACCACCATCGAAAACACCTGCTGTTCGCCTACACCAGGTGGTCTTGTTCTTTCCACCCAGTTCTGGAGCACATAC
ACAGGCCTTGAAAATAGGGGGCAGAAACTGCCGAAAGATAGTTGGACCCTCCATGGTCTTTGGCCCGATAACTGT
GATGGTTCCTTCGAACAATACTGTGATTTCTCGAGACAGTTTGATCCCGCACCTGATCCAGCCGTCCTACCCAAC
GGTGTTCCCGTCCCGGTCTACAAGGGACCAGGTGTCGATGTCTTTATCAAACAATTTGGGAAGAACAAACTTCTG
GATTACATGAACACCTACTGGATCGCCCAGGGCACACCTAACGCGGATTTCTGGGCTCATGAATTTTCTAAGCAT
GCTACATGCACTTCGACTTTTGATGTTGCTTGCTACGGAGAGGACTACCAGAAACATGTTGAAGTGATCGACTTT
TTCGAGACTGCCATCAGATTTTTCCAAAATTTCCCTACCTTCAAGCTCCTTGCTGCCGCAAATATCGTTCCTTCT
AACAAGACCATGTACAAGCTCGATGACTTAGAGGCTGCTGTTATATCACAGCTCGGCGCTGTCCCTTACTTTGGA
TGCACGCATAATGGCACTGTTCTTTCCGAAGTGTGGTACTTTACCCACGTCTTTGGAACTGAACAATTTGGAAGT
ATCAAGACTATCGAATCAGTCACCCCGTCAAGTTGTAATAGGAGTGGTGATATTTGGTATTATGAACGCACTGCG
GATAGTGAACGGGATGTTGAGTTTTAA
Transcript >AgabiH97|003310
ATGAAGGCGCAAAGCACTGCATCCTTTTTGTTCCTGGTCACAAGTTCTTTCGCCAGCTCTGTCCTCGGGAACTGC
GATCAAAGCCCCCAGTTCTATCCTAATCTCGCCAAGTGCATCAGCGAGCAATCTTTTTTCTCCTGCGAGAATACC
ACCACCATCGAAAACACCTGCTGTTCGCCTACACCAGGTGGTCTTGTTCTTTCCACCCAGTTCTGGAGCACATAC
ACAGGCCTTGAAAATAGGGGGCAGAAACTGCCGAAAGATAGTTGGACCCTCCATGGTCTTTGGCCCGATAACTGT
GATGGTTCCTTCGAACAATACTGTGATTTCTCGAGACAGTTTGATCCCGCACCTGATCCAGCCGTCCTACCCAAC
GGTGTTCCCGTCCCGGTCTACAAGGGACCAGGTGTCGATGTCTTTATCAAACAATTTGGGAAGAACAAACTTCTG
GATTACATGAACACCTACTGGATCGCCCAGGGCACACCTAACGCGGATTTCTGGGCTCATGAATTTTCTAAGCAT
GCTACATGCACTTCGACTTTTGATGTTGCTTGCTACGGAGAGGACTACCAGAAACATGTTGAAGTGATCGACTTT
TTCGAGACTGCCATCAGATTTTTCCAAAATTTCCCTACCTTCAAGCTCCTTGCTGCCGCAAATATCGTTCCTTCT
AACAAGACCATGTACAAGCTCGATGACTTAGAGGCTGCTGTTATATCACAGCTCGGCGCTGTCCCTTACTTTGGA
TGCACGCATAATGGCACTGTTCTTTCCGAAGTGTGGTACTTTACCCACGTCTTTGGAACTGAACAATTTGGAAGT
ATCAAGACTATCGAATCAGTCACCCCGTCAAGTTGTAATAGGAGTGGTGATATTTGGTATTATGAACGCACTGCG
GATAGTGAACGGGATGTTGAGTTTTAA
Gene >AgabiH97|003310
ATGAAGGCGCAAAGCACTGCATCCTTTTTGTTCCTGGTCACAAGTTCTTTCGCCAGCTCTGTCCTCGGGAACTGC
GATCAAAGCCCCCAGTTCTATCCTAATCTCGCCAAGTGCATCAGCGAGCAATCTTTTTTCTCCTGCGAGAATACC
ACCACCATCGAAAACACCTGCTGTTCGCCTACACCAGGTGGTCTTGTTCTTTCCACCCAGTTCTGGAGCACATAC
ACAGGCCTTGAAAATAGGGGGCAGAAACTGCCGAAAGATAGTTGGACCCTCCATGGTCTTTGGCCCGATAACTGT
GATGGGTGTGTGTCATGGTGTTTGAGCTACGTGATCTTATTAAGAAAATAATTTTAGTTCCTTCGAACAATACTG
TGATTTCTCGAGACAGTTTGATCCCGCACCTGATCCAGCCGTCCTACCCAACGGTGTTCCCGTCCCGGTCTACAA
GGGACCAGGTGTCGATGTCTTTATCAAACAATTTGGGAAGAACAAACTTCTGGATTACAGTATGTTTAAATTATC
ACAGACATCGTGTTTTCTGATGGTTCGTCGCAAGTGAACACCTACTGGATCGCCCAGGGCACACCTAACGCGGAT
TTCTGGGCTCATGAAGTAAGTTATGAATTCGTACATACGGTTTAGAGAAGAATGCTAAGTTCTTTGTTAGTTTTC
TAAGCATGCTACATGCACTTCGACTTTTGATGTTGCTTGCTACGGAGAGGACTACCAGAAACATGTTGAAGTGAT
CGACTTTTTCGAGACTGCCATCAGATTTTTCCAAAATTTCCCTACCTTCAAGCTCCTTGCTGCGTAAATCCCCGT
TTTGATTTTTGGAGCCCACATCTGATTCCTCAACGATACTTGCATCCAGCGCAAATATCGTTCCTTCTAACAAGA
CCATGTACAAGCTCGATGACTTAGAGGCTGCTGTTATATCACAGCTCGGCGCTGTCCCTTACTTTGGATGCACGC
ATAATGGCACTGTTCTTTCCGAAGTGTGGTACTTTACCCACGTCTTTGGAACTGTAAGTTGTGATTTCGTTCTTG
TTACACTGAACAATACTTGATATAATAATCATCCTAGGAACAATTTGGAAGTATCAAGACTATCGAATCAGTCAC
CCCGTCAAGTTGTAATAGGAGTGGTGATATTTGGTATTATGAACGCACTGCGGATAGTGAACGGGATGTTGAGTT
TTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail