Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|003210
Gene name
Locationscaffold_1:812295..813482
Strand-
Gene length (bp)1187
Transcript length (bp)1035
Coding sequence length (bp)1035
Protein length (aa) 345

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03998 Utp11 Utp11 protein 5.9E-74 11 344

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10106|UTP11_SCHPO Probable U3 small nucleolar RNA-associated protein 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp11 PE=3 SV=1 1 344 1.0E-33
sp|Q8S1Z1|UTP11_ORYSJ Probable U3 small nucleolar RNA-associated protein 11 OS=Oryza sativa subsp. japonica GN=Os01g0810000 PE=2 SV=2 3 121 2.0E-24
sp|Q9CZJ1|UTP11_MOUSE Probable U3 small nucleolar RNA-associated protein 11 OS=Mus musculus GN=Utp11l PE=2 SV=1 1 121 2.0E-24
sp|P34247|UTP11_YEAST U3 small nucleolar RNA-associated protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP11 PE=1 SV=2 3 121 3.0E-24
sp|A6ZZL7|UTP11_YEAS7 U3 small nucleolar RNA-associated protein 11 OS=Saccharomyces cerevisiae (strain YJM789) GN=UTP11 PE=3 SV=1 3 121 3.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10106|UTP11_SCHPO Probable U3 small nucleolar RNA-associated protein 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=utp11 PE=3 SV=1 1 344 1.0E-33
sp|Q8S1Z1|UTP11_ORYSJ Probable U3 small nucleolar RNA-associated protein 11 OS=Oryza sativa subsp. japonica GN=Os01g0810000 PE=2 SV=2 3 121 2.0E-24
sp|Q9CZJ1|UTP11_MOUSE Probable U3 small nucleolar RNA-associated protein 11 OS=Mus musculus GN=Utp11l PE=2 SV=1 1 121 2.0E-24
sp|P34247|UTP11_YEAST U3 small nucleolar RNA-associated protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UTP11 PE=1 SV=2 3 121 3.0E-24
sp|A6ZZL7|UTP11_YEAS7 U3 small nucleolar RNA-associated protein 11 OS=Saccharomyces cerevisiae (strain YJM789) GN=UTP11 PE=3 SV=1 3 121 3.0E-24
sp|B5VM59|UTP11_YEAS6 U3 small nucleolar RNA-associated protein 11 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=UTP11 PE=3 SV=1 3 121 3.0E-24
sp|Q9M223|UTP11_ARATH Probable U3 small nucleolar RNA-associated protein 11 OS=Arabidopsis thaliana GN=At3g60360 PE=1 SV=1 3 126 2.0E-23
sp|Q9Y3A2|UTP11_HUMAN Probable U3 small nucleolar RNA-associated protein 11 OS=Homo sapiens GN=UTP11L PE=1 SV=2 1 121 3.0E-21
sp|Q8R5K5|UTP11_RAT Probable U3 small nucleolar RNA-associated protein 11 OS=Rattus norvegicus GN=Utp11l PE=2 SV=1 1 121 6.0E-21
sp|Q55C50|UTP11_DICDI Probable U3 small nucleolar RNA-associated protein 11 OS=Dictyostelium discoideum GN=utp11 PE=3 SV=1 1 124 9.0E-16
sp|Q9W3C0|UTP11_DROME Probable U3 small nucleolar RNA-associated protein 11 OS=Drosophila melanogaster GN=CG1789 PE=2 SV=1 14 144 3.0E-12
sp|Q09462|UTP11_CAEEL Probable U3 small nucleolar RNA-associated protein 11 OS=Caenorhabditis elegans GN=C16C10.2 PE=3 SV=1 11 121 1.0E-09
sp|Q9U178|UTP11_LEIMA Probable U3 small nucleolar RNA-associated protein 11 OS=Leishmania major GN=L374.02 PE=3 SV=1 2 70 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0032040 small-subunit processome Yes
GO:0006364 rRNA processing Yes
GO:0090304 nucleic acid metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1990904 ribonucleoprotein complex No
GO:0034470 ncRNA processing No
GO:0016070 RNA metabolic process No
GO:0006396 RNA processing No
GO:1901360 organic cyclic compound metabolic process No
GO:0005575 cellular_component No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0030684 preribosome No
GO:0032991 protein-containing complex No
GO:0016072 rRNA metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|003210
MTSSLRNSLHRRNHKERSQLAHRTKLGILEKHKDYVQRARDYHSKQDRLTRLRQKAADRNKDEFYFSMIKEKTKG
GVHIKDRGNTALPVDIVKVLKTQDENYVRTMRTSNAKKIDSLKNQLTTMADLIRDPLVEDDEEGLDEGELKVLRE
AGILQTPKNRKRRKTNHILFADSIEEAKQLTSQPPKRLLPENTQSSATSPLTEVDLGWKSDERKRKRRKPSRPIV
LTTENVEDDTSDLDIAHDGSQPQTTTKHRLLKELSARLRRDLQLRYAQREFEMQRLLMGKGARKKIAGVEKANGD
QESDEEEDQDEIDARKGRRRNTTKKVDEETYKPRVYKWKSERKR*
Coding >AgabiH97|003210
ATGACGTCCTCCCTCCGGAATTCCCTCCATCGGAGGAACCACAAGGAGCGCTCGCAGCTAGCCCACCGCACGAAA
CTTGGCATCCTCGAGAAACACAAAGACTATGTCCAACGAGCCAGGGACTATCACTCCAAGCAGGATAGGCTGACC
CGCCTCAGGCAAAAGGCTGCCGACCGCAACAAAGATGAATTCTACTTTTCTATGATCAAAGAAAAGACGAAGGGA
GGTGTGCATATCAAGGATCGAGGAAATACTGCTCTGCCAGTCGATATCGTTAAAGTGCTCAAAACTCAAGACGAG
AACTATGTCCGGACGATGCGTACATCCAATGCAAAGAAAATCGACAGCCTCAAAAACCAATTAACCACCATGGCA
GATCTAATAAGAGACCCCTTGGTTGAGGATGACGAAGAGGGTCTCGATGAAGGCGAGCTCAAGGTTCTTCGTGAA
GCAGGTATACTGCAGACGCCTAAAAATCGTAAACGGCGGAAAACCAATCATATCCTATTTGCTGACTCGATAGAA
GAAGCAAAACAGCTAACTTCGCAACCTCCCAAACGACTCCTTCCCGAAAACACCCAATCTTCCGCAACTTCTCCT
TTGACCGAAGTTGATCTTGGCTGGAAGTCTGACGAACGAAAACGGAAGCGCCGAAAACCATCTCGTCCTATTGTC
CTTACCACAGAGAATGTAGAGGACGATACTTCTGATCTCGATATTGCACACGACGGTTCCCAACCGCAAACCACC
ACGAAACACCGTCTCCTAAAAGAACTTTCCGCCCGGCTCCGGCGAGACTTACAATTGCGCTATGCACAACGTGAA
TTCGAAATGCAACGGCTGCTCATGGGGAAGGGAGCCCGCAAGAAGATTGCTGGAGTAGAAAAGGCGAATGGAGAT
CAGGAATCCGATGAGGAGGAAGATCAGGATGAGATTGATGCACGGAAAGGTAGACGGCGAAACACAACCAAGAAG
GTGGATGAAGAGACTTACAAACCTCGAGTTTACAAATGGAAGAGCGAGCGTAAGCGGTAA
Transcript >AgabiH97|003210
ATGACGTCCTCCCTCCGGAATTCCCTCCATCGGAGGAACCACAAGGAGCGCTCGCAGCTAGCCCACCGCACGAAA
CTTGGCATCCTCGAGAAACACAAAGACTATGTCCAACGAGCCAGGGACTATCACTCCAAGCAGGATAGGCTGACC
CGCCTCAGGCAAAAGGCTGCCGACCGCAACAAAGATGAATTCTACTTTTCTATGATCAAAGAAAAGACGAAGGGA
GGTGTGCATATCAAGGATCGAGGAAATACTGCTCTGCCAGTCGATATCGTTAAAGTGCTCAAAACTCAAGACGAG
AACTATGTCCGGACGATGCGTACATCCAATGCAAAGAAAATCGACAGCCTCAAAAACCAATTAACCACCATGGCA
GATCTAATAAGAGACCCCTTGGTTGAGGATGACGAAGAGGGTCTCGATGAAGGCGAGCTCAAGGTTCTTCGTGAA
GCAGGTATACTGCAGACGCCTAAAAATCGTAAACGGCGGAAAACCAATCATATCCTATTTGCTGACTCGATAGAA
GAAGCAAAACAGCTAACTTCGCAACCTCCCAAACGACTCCTTCCCGAAAACACCCAATCTTCCGCAACTTCTCCT
TTGACCGAAGTTGATCTTGGCTGGAAGTCTGACGAACGAAAACGGAAGCGCCGAAAACCATCTCGTCCTATTGTC
CTTACCACAGAGAATGTAGAGGACGATACTTCTGATCTCGATATTGCACACGACGGTTCCCAACCGCAAACCACC
ACGAAACACCGTCTCCTAAAAGAACTTTCCGCCCGGCTCCGGCGAGACTTACAATTGCGCTATGCACAACGTGAA
TTCGAAATGCAACGGCTGCTCATGGGGAAGGGAGCCCGCAAGAAGATTGCTGGAGTAGAAAAGGCGAATGGAGAT
CAGGAATCCGATGAGGAGGAAGATCAGGATGAGATTGATGCACGGAAAGGTAGACGGCGAAACACAACCAAGAAG
GTGGATGAAGAGACTTACAAACCTCGAGTTTACAAATGGAAGAGCGAGCGTAAGCGGTAA
Gene >AgabiH97|003210
ATGACGTCCTCCCTCCGGAATTCCCTCCATCGGAGGAACCACAAGGAGCGCTCGCAGCTAGCCCACCGCACGAAA
CTTGGCATCCTCGAGAAACACAAAGACTATGTCCAACGAGCCAGGGACTATCACTCCAAGCAGGATAGGCTGACC
CGCCTCAGGCAAAAGGCTGCCGACCGCAACAAAGATGAATTCTACTTTTCTATGATCAAAGAAAAGACGAAGGTG
CGAGAATCACCTATTAGCGACACTGTCAAAATTCTCATTGTTTGAAAGGGAGGTGTGCATATCAAGGATCGAGGA
AATACTGCTCTGCCAGTCGATATCGTTAAAGTGCTCAAAACTCAAGACGAGAACTATGTCCGGACGATGCGTACA
TCCAATGCAAAGGTCAGTGTTACTATTTTGACTTGCATGTCCGTTATTCACCATCTCACCAGAAAATCGACAGCC
TCAAAAACCAATTAACCACCATGGCAGATCTAATAAGAGACCCCTTGGTTGAGGATGACGAAGAGGGTCTCGATG
AAGGCGAGCTCAAGGTTCTTCGTGAAGCAGGTATACTGCAGACGCCTAAAAATCGTAAACGGCGGAAAACCAATC
ATATCCTATTTGCTGACTCGATAGAAGAAGGTATAACCTACTTCCCTTGCTTGCAAGTCGACCAATAACCTCGCA
TTATAGCAAAACAGCTAACTTCGCAACCTCCCAAACGACTCCTTCCCGAAAACACCCAATCTTCCGCAACTTCTC
CTTTGACCGAAGTTGATCTTGGCTGGAAGTCTGACGAACGAAAACGGAAGCGCCGAAAACCATCTCGTCCTATTG
TCCTTACCACAGAGAATGTAGAGGACGATACTTCTGATCTCGATATTGCACACGACGGTTCCCAACCGCAAACCA
CCACGAAACACCGTCTCCTAAAAGAACTTTCCGCCCGGCTCCGGCGAGACTTACAATTGCGCTATGCACAACGTG
AATTCGAAATGCAACGGCTGCTCATGGGGAAGGGAGCCCGCAAGAAGATTGCTGGAGTAGAAAAGGCGAATGGAG
ATCAGGAATCCGATGAGGAGGAAGATCAGGATGAGATTGATGCACGGAAAGGTAGACGGCGAAACACAACCAAGA
AGGTGGATGAAGAGACTTACAAACCTCGAGTTTACAAATGGAAGAGCGAGCGTAAGCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail