Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|003200
Gene name
Locationscaffold_1:810637..812175
Strand+
Gene length (bp)1538
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AUX6|A8043_ARTBC Uncharacterized secreted protein ARB_08043 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_08043 PE=1 SV=1 39 316 8.0E-76
sp|D4AK17|PLCX1_ARTBC PI-PLC X domain-containing protein 1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04618 PE=1 SV=1 38 314 3.0E-65
sp|Q93XX5|Y5713_ARATH PI-PLC X domain-containing protein At5g67130 OS=Arabidopsis thaliana GN=At5g67130 PE=1 SV=1 74 337 4.0E-16

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|003200
MRLIVATRLLTQLSFVLFPSVLSVLGAPNSGVGRRATVCNGHAELCDKSYGSVVSVGSHDSYAIAAGSSNVAANQ
DQNITTQLDDGIRMLQMQAHNENGVIKLCHTACVIFDGGTLQDYLTEVKSWLDANPNEVLSLLIVNSDSVPVSTY
DEVFKSVGLDTMGFIPPSLPLPALSWPTLGSMIDSGKRLVTFMDHEADGSVPYIIDEFTNVWETAFNVVDPTFDC
NVNRTNTQVETASQMYLINHFLDKIILGNPAPDIEKLNVTNAATGPGSLGAQVETCVAQNSKPPNFLLVDFYEFG
QGSVFQVAADLNGVQYTPTKPIATPVQGGASTSSSAQTSSRPLDNGDNPVLNFSWESILSLMSVVTAVLAGPQFL
L*
Coding >AgabiH97|003200
ATGCGACTAATCGTCGCCACACGGCTACTAACACAACTTTCCTTTGTTCTTTTCCCATCAGTCCTTTCGGTGCTC
GGTGCTCCTAACTCAGGAGTTGGACGCCGTGCCACTGTGTGCAACGGACATGCTGAACTCTGTGACAAAAGCTAC
GGATCGGTCGTCTCCGTCGGCTCTCATGATTCATATGCCATTGCTGCTGGTTCATCCAATGTCGCTGCCAATCAG
GATCAGAACATCACCACCCAGCTCGACGATGGAATCCGAATGCTTCAAATGCAGGCGCACAATGAGAATGGAGTC
ATTAAGCTCTGCCACACGGCTTGCGTCATTTTCGATGGTGGAACCCTCCAAGACTACCTCACCGAAGTGAAAAGC
TGGCTTGACGCGAACCCGAATGAAGTGCTTTCGCTCTTGATAGTTAATTCGGATAGTGTGCCCGTCTCTACGTAT
GACGAAGTCTTCAAGTCAGTGGGCCTTGACACTATGGGCTTTATCCCTCCATCCCTTCCCCTGCCAGCTCTTTCT
TGGCCAACCCTAGGAAGCATGATTGATTCAGGAAAGCGTCTTGTCACCTTCATGGACCATGAAGCCGATGGTTCG
GTTCCCTACATCATTGATGAGTTTACCAACGTTTGGGAAACAGCGTTCAATGTCGTTGATCCTACATTCGACTGC
AACGTTAACAGGACCAACACCCAGGTCGAGACCGCTAGTCAAATGTACCTCATCAATCACTTCCTTGATAAAATC
ATCCTTGGCAATCCTGCTCCCGACATTGAAAAGCTGAATGTGACGAATGCTGCCACGGGTCCTGGGTCTCTCGGC
GCGCAAGTAGAAACATGCGTTGCGCAGAACTCTAAACCGCCCAACTTTTTGCTTGTGGACTTTTATGAATTCGGT
CAAGGATCAGTTTTCCAGGTTGCCGCCGACCTCAACGGCGTGCAGTACACCCCAACCAAACCCATTGCCACTCCA
GTTCAAGGAGGTGCATCGACATCATCTTCCGCCCAAACTTCCAGCAGACCGCTCGATAACGGAGACAATCCTGTA
CTCAACTTCTCCTGGGAGAGTATACTATCGTTGATGTCTGTGGTCACGGCAGTACTGGCAGGGCCTCAGTTTCTA
CTATAA
Transcript >AgabiH97|003200
ATGCGACTAATCGTCGCCACACGGCTACTAACACAACTTTCCTTTGTTCTTTTCCCATCAGTCCTTTCGGTGCTC
GGTGCTCCTAACTCAGGAGTTGGACGCCGTGCCACTGTGTGCAACGGACATGCTGAACTCTGTGACAAAAGCTAC
GGATCGGTCGTCTCCGTCGGCTCTCATGATTCATATGCCATTGCTGCTGGTTCATCCAATGTCGCTGCCAATCAG
GATCAGAACATCACCACCCAGCTCGACGATGGAATCCGAATGCTTCAAATGCAGGCGCACAATGAGAATGGAGTC
ATTAAGCTCTGCCACACGGCTTGCGTCATTTTCGATGGTGGAACCCTCCAAGACTACCTCACCGAAGTGAAAAGC
TGGCTTGACGCGAACCCGAATGAAGTGCTTTCGCTCTTGATAGTTAATTCGGATAGTGTGCCCGTCTCTACGTAT
GACGAAGTCTTCAAGTCAGTGGGCCTTGACACTATGGGCTTTATCCCTCCATCCCTTCCCCTGCCAGCTCTTTCT
TGGCCAACCCTAGGAAGCATGATTGATTCAGGAAAGCGTCTTGTCACCTTCATGGACCATGAAGCCGATGGTTCG
GTTCCCTACATCATTGATGAGTTTACCAACGTTTGGGAAACAGCGTTCAATGTCGTTGATCCTACATTCGACTGC
AACGTTAACAGGACCAACACCCAGGTCGAGACCGCTAGTCAAATGTACCTCATCAATCACTTCCTTGATAAAATC
ATCCTTGGCAATCCTGCTCCCGACATTGAAAAGCTGAATGTGACGAATGCTGCCACGGGTCCTGGGTCTCTCGGC
GCGCAAGTAGAAACATGCGTTGCGCAGAACTCTAAACCGCCCAACTTTTTGCTTGTGGACTTTTATGAATTCGGT
CAAGGATCAGTTTTCCAGGTTGCCGCCGACCTCAACGGCGTGCAGTACACCCCAACCAAACCCATTGCCACTCCA
GTTCAAGGAGGTGCATCGACATCATCTTCCGCCCAAACTTCCAGCAGACCGCTCGATAACGGAGACAATCCTGTA
CTCAACTTCTCCTGGGAGAGTATACTATCGTTGATGTCTGTGGTCACGGCAGTACTGGCAGGGCCTCAGTTTCTA
CTATAA
Gene >AgabiH97|003200
ATGCGACTAATCGTCGCCACACGGCTACTAACACAACTTTCCTTTGTTCTTTTCCCATCAGTCCTTTCGGTGCTC
GGTGCTCCTAACTCAGGAGTTGGACGCCGTGCCACTGTGTGCAACGGACATGCTGAACTCTGTGACAAAAGCTAC
GGATCGGTCGTCTCCGTCGGCTCTCATGATTCATATGCCATTGCTGCTGGTTCATCCAATGGTAAGCTCAAAATT
GCTTCACCTTTGATGACAATAGTCTGAACAAGGATTATCTCTCTAGTCGCTGCCAATCAGGATCAGAACAGTGCG
TTTTCTATTTCATTTATCTAATAGTTCTTGGCTTACACTAGAGTAATTATACAGTCACCACCCAGCTCGACGATG
GAATCCGAATGCTTCAAATGCAGGCGCACAATGAGAATGGAGTCATTAAGCTCTGCCACACGGCTTGCGTGGGTT
TATTAGCATCTTTGGCGTGAAATGTGGTTCATAAACTTCAAATACAGGTCATTTTCGATGGTGGAACCCTCCAAG
ACTACCTCACCGAAGGTGAGCTATTGTGACTATGCAACGCCTCACATGCCTCATTATTGTCTTTGACAGTGAAAA
GCTGGCTTGACGCGAACCCGAATGAAGGTGCGATACGCTGATATATGTGCGAGTCGAGATGAAAATTGACCCCGG
TTGAAGTGCTTTCGCTCTTGATAGTTAATTCGGATAGTGTGCCCGTCTCTACGTATGACGAAGTCTTCAAGTCAG
TGGGCCTTGACACTATGGGCTTTATCCCTCCATCCCTTCCCCTGCCAGCTCTTTCTTGGCCAACCCTAGGAAGCA
TGATTGATTCAGGAAAGCGTCTTGTCACCTTCATGGACCATGAAGCCGATGGTTCGGTTCCCTACATCATTGATG
GTCTGTGATCTTTACTTCTGATTGTCTTCGGAGTTTTTTTTCCTTACAATTCGCAACAGAGTTTACCAACGTTTG
GGAAACAGCGTTCAATGTCGTTGATCCTACATTCGACTGCAACGTTAACAGGACCAACACCCAGGTCGAGACCGC
TAGTCAAATGTACCTCATCAATCACTTCCTTGATAAAATCATCCTTGGCAATCCTGCTCCCGACATTGAAAAGCT
GAATGTGACGAATGCTGCCACGGGTCCTGGGTCTCTCGGCGCGCAAGTAGAAACATGCGTTGCGCAGAACTCTAA
ACCGCCCAACTTTTTGCTTGTGGACGTAAGTACTTTTTTCTCTTGCGTCTAGTTTTGATTAGAACTCATTTTGAA
AATTTGTCTTTGGGTAGTTTTATGAATTCGGTCAAGGATCAGTTTTCCAGGTTGCCGCCGACCTCAACGGCGTGC
AGTACACCCCAACCAAACCCATTGCCACTCCAGTTCAAGGAGGTGCATCGACATCATCTTCCGCCCAAACTTCCA
GCAGACCGCTCGATAACGGAGACAATCCTGTACTCAACTTCTCCTGGGAGAGTATACTATCGTTGATGTCTGTGG
TCACGGCAGTACTGGCAGGGCCTCAGTTTCTACTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail