Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|003180
Gene name
Locationscaffold_1:807479..808214
Strand-
Gene length (bp)735
Transcript length (bp)627
Coding sequence length (bp)627
Protein length (aa) 209

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13405 EF-hand_6 EF-hand domain 7.1E-06 47 76
PF13499 EF-hand_7 EF-hand domain pair 3.0E-09 46 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5E9E2|MYL9_BOVIN Myosin regulatory light polypeptide 9 OS=Bos taurus GN=MYL9 PE=2 SV=3 28 195 2.0E-34
sp|Q3THE2|ML12B_MOUSE Myosin regulatory light chain 12B OS=Mus musculus GN=Myl12b PE=1 SV=2 28 195 2.0E-34
sp|O14950|ML12B_HUMAN Myosin regulatory light chain 12B OS=Homo sapiens GN=MYL12B PE=1 SV=2 28 195 2.0E-34
sp|P24032|MLRN_CHICK Myosin regulatory light chain 2, smooth muscle minor isoform OS=Gallus gallus PE=2 SV=2 28 195 2.0E-34
sp|P18666|ML12B_RAT Myosin regulatory light chain 12B OS=Rattus norvegicus GN=Myl12b PE=1 SV=3 28 195 2.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5E9E2|MYL9_BOVIN Myosin regulatory light polypeptide 9 OS=Bos taurus GN=MYL9 PE=2 SV=3 28 195 2.0E-34
sp|Q3THE2|ML12B_MOUSE Myosin regulatory light chain 12B OS=Mus musculus GN=Myl12b PE=1 SV=2 28 195 2.0E-34
sp|O14950|ML12B_HUMAN Myosin regulatory light chain 12B OS=Homo sapiens GN=MYL12B PE=1 SV=2 28 195 2.0E-34
sp|P24032|MLRN_CHICK Myosin regulatory light chain 2, smooth muscle minor isoform OS=Gallus gallus PE=2 SV=2 28 195 2.0E-34
sp|P18666|ML12B_RAT Myosin regulatory light chain 12B OS=Rattus norvegicus GN=Myl12b PE=1 SV=3 28 195 2.0E-34
sp|Q5RC34|ML12A_PONAB Myosin regulatory light chain 12A OS=Pongo abelii GN=MYL12A PE=2 SV=3 30 195 7.0E-34
sp|P19105|ML12A_HUMAN Myosin regulatory light chain 12A OS=Homo sapiens GN=MYL12A PE=1 SV=2 30 195 7.0E-34
sp|A4IF97|ML12B_BOVIN Myosin regulatory light chain 12B OS=Bos taurus GN=MYL12B PE=2 SV=1 28 195 1.0E-33
sp|P13832|MRLCA_RAT Myosin regulatory light chain RLC-A OS=Rattus norvegicus GN=Rlc-a PE=2 SV=2 28 195 1.0E-33
sp|Q9CQ19|MYL9_MOUSE Myosin regulatory light polypeptide 9 OS=Mus musculus GN=Myl9 PE=1 SV=3 30 195 3.0E-33
sp|Q5RBA4|MYL9_PONAB Myosin regulatory light polypeptide 9 OS=Pongo abelii GN=MYL9 PE=2 SV=3 30 195 2.0E-32
sp|P29269|MYL9_PIG Myosin regulatory light polypeptide 9 OS=Sus scrofa GN=MYL9 PE=1 SV=2 30 195 2.0E-32
sp|P24844|MYL9_HUMAN Myosin regulatory light polypeptide 9 OS=Homo sapiens GN=MYL9 PE=1 SV=4 30 195 2.0E-32
sp|Q09510|MLRH_CAEEL Myosin regulatory light chain OS=Caenorhabditis elegans GN=mlc-4 PE=1 SV=1 24 195 3.0E-32
sp|P02612|MLRM_CHICK Myosin regulatory light chain 2, smooth muscle major isoform OS=Gallus gallus PE=1 SV=2 30 195 4.0E-32
sp|Q64122|MYL9_RAT Myosin regulatory light polypeptide 9 OS=Rattus norvegicus GN=Myl9 PE=1 SV=2 34 195 3.0E-31
sp|P40423|SQH_DROME Myosin regulatory light chain sqh OS=Drosophila melanogaster GN=sqh PE=1 SV=1 19 195 2.0E-30
sp|Q7M2V4|MLRV_RABIT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Oryctolagus cuniculus GN=MYL2 PE=1 SV=2 22 199 7.0E-30
sp|P10916|MLRV_HUMAN Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Homo sapiens GN=MYL2 PE=1 SV=3 22 199 1.0E-29
sp|Q3SZE5|MLRV_BOVIN Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Bos taurus GN=MYL2 PE=1 SV=1 22 199 4.0E-29
sp|P51667|MLRV_MOUSE Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Mus musculus GN=Myl2 PE=1 SV=3 22 199 2.0E-28
sp|P08733|MLRV_RAT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Rattus norvegicus GN=Myl2 PE=1 SV=2 22 199 3.0E-28
sp|P41691|MYL5_FELCA Myosin light chain 5 OS=Felis catus GN=MYL5 PE=2 SV=2 13 202 7.0E-27
sp|Q01449|MLRA_HUMAN Myosin regulatory light chain 2, atrial isoform OS=Homo sapiens GN=MYL7 PE=1 SV=1 28 202 6.0E-26
sp|Q9QVP4|MLRA_MOUSE Myosin regulatory light chain 2, atrial isoform OS=Mus musculus GN=Myl7 PE=1 SV=1 28 202 3.0E-25
sp|Q02045|MYL5_HUMAN Myosin light chain 5 OS=Homo sapiens GN=MYL5 PE=2 SV=1 13 202 3.0E-25
sp|P02610|MLRA_CHICK Myosin regulatory light chain 2A, cardiac muscle isoform OS=Gallus gallus PE=1 SV=2 22 199 4.0E-25
sp|Q62082|MYL10_MOUSE Myosin regulatory light chain 10 OS=Mus musculus GN=Myl10 PE=2 SV=1 25 199 2.0E-23
sp|P02611|MLRB_CHICK Myosin regulatory light chain 2B, cardiac muscle isoform OS=Gallus gallus PE=1 SV=2 22 199 5.0E-23
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 44 194 2.0E-22
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 44 194 2.0E-22
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 44 194 9.0E-22
sp|P84339|CALM_AGABI Calmodulin OS=Agaricus bisporus PE=1 SV=2 44 194 1.0E-21
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 44 194 1.0E-21
sp|P02598|CALM_TETPY Calmodulin OS=Tetrahymena pyriformis PE=1 SV=4 44 194 2.0E-21
sp|Q71UH5|CALM_PYTSP Calmodulin OS=Pythium splendens PE=2 SV=1 44 194 2.0E-21
sp|P27165|CALM_PHYIN Calmodulin OS=Phytophthora infestans GN=CMD1 PE=3 SV=2 44 194 2.0E-21
sp|A8CEP3|CALM_SACJA Calmodulin OS=Saccharina japonica GN=cam PE=2 SV=1 44 194 2.0E-21
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 44 196 3.0E-21
sp|P07463|CALM_PARTE Calmodulin OS=Paramecium tetraurelia GN=CAM PE=1 SV=3 44 194 3.0E-21
sp|P06787|CALM_YEAST Calmodulin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMD1 PE=1 SV=1 44 194 4.0E-21
sp|P27164|CALM3_PETHY Calmodulin-related protein OS=Petunia hybrida GN=CAM53 PE=2 SV=2 44 197 4.0E-21
sp|A3E4D8|CALM_PROMN Calmodulin OS=Prorocentrum minimum PE=2 SV=1 44 194 4.0E-21
sp|A3E3H0|CALM_PFIPI Calmodulin OS=Pfiesteria piscicida PE=2 SV=1 44 194 4.0E-21
sp|A3E4F9|CALM_KARVE Calmodulin OS=Karlodinium veneficum PE=2 SV=1 44 194 4.0E-21
sp|A4UHC0|CALM_ALEFU Calmodulin OS=Alexandrium fundyense PE=2 SV=1 44 194 4.0E-21
sp|P53440|CALMF_NAEGR Calmodulin, flagellar OS=Naegleria gruberi GN=CAM1 PE=2 SV=1 44 194 5.0E-21
sp|Q682T9|CALM5_ARATH Calmodulin-5 OS=Arabidopsis thaliana GN=CAM5 PE=1 SV=1 44 194 6.0E-21
sp|P0DH98|CALM3_ARATH Calmodulin-3 OS=Arabidopsis thaliana GN=CAM3 PE=1 SV=1 44 194 6.0E-21
sp|P0DH97|CALM2_ARATH Calmodulin-2 OS=Arabidopsis thaliana GN=CAM2 PE=1 SV=1 44 194 6.0E-21
sp|P11120|CALM_PLECO Calmodulin OS=Pleurotus cornucopiae GN=CMD1 PE=1 SV=2 44 194 7.0E-21
sp|O94739|CALM_PLEOS Calmodulin OS=Pleurotus ostreatus GN=CMD1 PE=2 SV=3 44 194 7.0E-21
sp|Q8X187|CALM_PAXIN Calmodulin OS=Paxillus involutus GN=calA PE=2 SV=3 44 194 8.0E-21
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 44 194 9.0E-21
sp|Q95NR9|CALM_METSE Calmodulin OS=Metridium senile PE=1 SV=3 44 194 1.0E-20
sp|O60041|CALM_KLULA Calmodulin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CMD1 PE=1 SV=1 44 194 1.0E-20
sp|Q6F332|CALM2_ORYSJ Calmodulin-2 OS=Oryza sativa subsp. japonica GN=CAM2 PE=2 SV=3 44 194 1.0E-20
sp|A2Y609|CALM2_ORYSI Calmodulin-2 OS=Oryza sativa subsp. indica GN=CAM2 PE=3 SV=1 44 194 1.0E-20
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 44 194 1.0E-20
sp|P11118|CALM_EUGGR Calmodulin OS=Euglena gracilis PE=1 SV=2 44 194 1.0E-20
sp|Q03509|CALM6_ARATH Calmodulin-6 OS=Arabidopsis thaliana GN=CAM6 PE=1 SV=2 44 194 1.0E-20
sp|Q7T3T2|CALM_EPIAK Calmodulin OS=Epinephelus akaara GN=calm PE=2 SV=3 44 194 2.0E-20
sp|P62184|CALM_RENRE Calmodulin OS=Renilla reniformis PE=1 SV=2 44 194 2.0E-20
sp|P17928|CALM_MEDSA Calmodulin OS=Medicago sativa GN=CAL1 PE=2 SV=2 44 194 2.0E-20
sp|P93171|CALM_HELAN Calmodulin OS=Helianthus annuus GN=CAM PE=2 SV=3 44 194 2.0E-20
sp|P62201|CALM_LILLO Calmodulin OS=Lilium longiflorum PE=2 SV=2 44 194 2.0E-20
sp|Q7Y052|CALM_EUPCH Calmodulin OS=Euphorbia characias PE=2 SV=4 44 194 2.0E-20
sp|P62202|CALM_BRYDI Calmodulin OS=Bryonia dioica PE=2 SV=2 44 194 2.0E-20
sp|P59220|CALM7_ARATH Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2 44 194 2.0E-20
sp|P62199|CALM1_PETHY Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=1 SV=2 44 194 2.0E-20
sp|P62200|CALM1_DAUCA Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 SV=2 44 194 2.0E-20
sp|P04353|CALM_SPIOL Calmodulin OS=Spinacia oleracea PE=1 SV=2 44 194 2.0E-20
sp|P62162|CALM_HORVU Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2 44 194 2.0E-20
sp|P62163|CALM2_SOYBN Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2 44 194 2.0E-20
sp|Q0JNS6|CALM1_ORYSJ Calmodulin-1 OS=Oryza sativa subsp. japonica GN=CAM1-1 PE=1 SV=2 44 194 2.0E-20
sp|A2WN93|CALM1_ORYSI Calmodulin-1 OS=Oryza sativa subsp. indica GN=CAM1-1 PE=1 SV=2 44 194 2.0E-20
sp|Q95NI4|CALM_HALOK Calmodulin OS=Halichondria okadai PE=2 SV=3 44 194 2.0E-20
sp|O96081|CALMB_HALRO Calmodulin-B OS=Halocynthia roretzi PE=3 SV=3 44 194 2.0E-20
sp|P04464|CALM_WHEAT Calmodulin OS=Triticum aestivum PE=1 SV=3 44 194 2.0E-20
sp|P93087|CALM_CAPAN Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3 44 194 2.0E-20
sp|Q7DMN9|CALM5_SOLTU Calmodulin-5/6/7/8 OS=Solanum tuberosum GN=PCM5 PE=1 SV=3 44 194 3.0E-20
sp|Q5U206|CALL3_RAT Calmodulin-like protein 3 OS=Rattus norvegicus GN=Calml3 PE=2 SV=1 44 194 3.0E-20
sp|P02594|CALM_ELEEL Calmodulin OS=Electrophorus electricus GN=calm PE=2 SV=2 44 194 3.0E-20
sp|A2WNH1|CALM3_ORYSI Calmodulin-3 OS=Oryza sativa subsp. indica GN=CAM3 PE=3 SV=2 44 194 3.0E-20
sp|P23286|CALM_CANAX Calmodulin OS=Candida albicans GN=CMD1 PE=3 SV=2 44 194 3.0E-20
sp|P62155|CALM_XENLA Calmodulin OS=Xenopus laevis GN=calm1 PE=1 SV=2 44 194 4.0E-20
sp|P62151|CALM_TORCA Calmodulin OS=Torpedo californica PE=1 SV=2 44 194 4.0E-20
sp|Q6YNX6|CALM_SHEEP Calmodulin OS=Ovis aries GN=CALM2 PE=2 SV=3 44 194 4.0E-20
sp|P62161|CALM_RAT Calmodulin OS=Rattus norvegicus GN=Calm1 PE=1 SV=2 44 194 4.0E-20
sp|P62160|CALM_RABIT Calmodulin OS=Oryctolagus cuniculus GN=CALM PE=1 SV=2 44 194 4.0E-20
sp|Q5RAD2|CALM_PONAB Calmodulin OS=Pongo abelii GN=CALM PE=2 SV=3 44 194 4.0E-20
sp|Q71UH6|CALM_PERFV Calmodulin OS=Perca flavescens GN=calm PE=2 SV=3 44 194 4.0E-20
sp|P62156|CALM_ONCSP Calmodulin OS=Oncorhynchus sp. GN=calm PE=1 SV=2 44 194 4.0E-20
sp|P62204|CALM_MOUSE Calmodulin OS=Mus musculus GN=Calm1 PE=1 SV=2 44 194 4.0E-20
sp|P62158|CALM_HUMAN Calmodulin OS=Homo sapiens GN=CALM1 PE=1 SV=2 44 194 4.0E-20
sp|Q6PI52|CALM_DANRE Calmodulin OS=Danio rerio GN=calm1a PE=2 SV=3 44 194 4.0E-20
sp|Q6IT78|CALM_CTEID Calmodulin OS=Ctenopharyngodon idella GN=calm PE=2 SV=3 44 194 4.0E-20
sp|P62149|CALM_CHICK Calmodulin OS=Gallus gallus GN=CALM PE=1 SV=2 44 194 4.0E-20
sp|P62157|CALM_BOVIN Calmodulin OS=Bos taurus GN=CALM PE=1 SV=2 44 194 4.0E-20
sp|P62144|CALM_ANAPL Calmodulin OS=Anas platyrhynchos GN=CALM PE=2 SV=2 44 194 4.0E-20
sp|Q9UB37|CALM2_BRALA Calmodulin-2 OS=Branchiostoma lanceolatum GN=CAM2 PE=2 SV=3 44 194 5.0E-20
sp|P11121|CALM_PYUSP Calmodulin OS=Pyuridae sp. PE=1 SV=2 44 194 5.0E-20
sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 44 194 6.0E-20
sp|O02367|CALM_CIOIN Calmodulin OS=Ciona intestinalis PE=2 SV=3 44 194 6.0E-20
sp|O16305|CALM_CAEEL Calmodulin OS=Caenorhabditis elegans GN=cmd-1 PE=1 SV=3 44 194 6.0E-20
sp|Q8STF0|CALM_STRIE Calmodulin OS=Strongylocentrotus intermedius PE=2 SV=3 44 194 6.0E-20
sp|P62154|CALM_LOCMI Calmodulin OS=Locusta migratoria PE=1 SV=2 44 194 6.0E-20
sp|P62152|CALM_DROME Calmodulin OS=Drosophila melanogaster GN=Cam PE=1 SV=2 44 194 6.0E-20
sp|P62145|CALM_APLCA Calmodulin OS=Aplysia californica GN=CAM PE=2 SV=2 44 194 6.0E-20
sp|P62153|CALMA_HALRO Calmodulin-A OS=Halocynthia roretzi PE=1 SV=2 44 194 6.0E-20
sp|P62148|CALM1_BRALA Calmodulin-1 OS=Branchiostoma lanceolatum PE=2 SV=2 44 194 6.0E-20
sp|P62147|CALM1_BRAFL Calmodulin-1 OS=Branchiostoma floridae PE=2 SV=2 44 194 6.0E-20
sp|Q9GRJ1|CALM_LUMRU Calmodulin OS=Lumbricus rubellus PE=2 SV=3 44 194 7.0E-20
sp|P15094|CALM_ACHKL Calmodulin OS=Achlya klebsiana GN=CMD1 PE=3 SV=3 44 194 7.0E-20
sp|P02609|MLRS_CHICK Myosin regulatory light chain 2, skeletal muscle isoform OS=Gallus gallus GN=MYLPF PE=1 SV=2 22 204 8.0E-20
sp|P02595|CALM_PATSP Calmodulin OS=Patinopecten sp. PE=1 SV=2 44 194 8.0E-20
sp|Q9D6P8|CALL3_MOUSE Calmodulin-like protein 3 OS=Mus musculus GN=Calml3 PE=2 SV=1 44 194 9.0E-20
sp|P0DH96|CALM4_ARATH Calmodulin-4 OS=Arabidopsis thaliana GN=CAM4 PE=1 SV=1 44 194 9.0E-20
sp|P0DH95|CALM1_ARATH Calmodulin-1 OS=Arabidopsis thaliana GN=CAM1 PE=2 SV=1 44 194 9.0E-20
sp|P41040|CALM_MAIZE Calmodulin OS=Zea mays GN=CALM1 PE=2 SV=2 44 194 9.0E-20
sp|P62150|CALM_ORYLA Calmodulin-A (Fragment) OS=Oryzias latipes GN=calm1 PE=2 SV=1 44 191 1.0E-19
sp|Q9U6D3|CALM_MYXGL Calmodulin OS=Myxine glutinosa PE=2 SV=3 44 194 1.0E-19
sp|P04113|MLRA_MIZYE Myosin regulatory light chain A, smooth adductor muscle OS=Mizuhopecten yessoensis PE=1 SV=1 24 195 1.0E-19
sp|Q9BUA6|MYL10_HUMAN Myosin regulatory light chain 10 OS=Homo sapiens GN=MYL10 PE=2 SV=2 4 199 1.0E-19
sp|Q0JNL7|CALM3_ORYSJ Calmodulin-3 OS=Oryza sativa subsp. japonica GN=CAM3 PE=3 SV=1 44 194 1.0E-19
sp|P04352|CALM_CHLRE Calmodulin OS=Chlamydomonas reinhardtii PE=1 SV=2 44 194 2.0E-19
sp|O97341|CALM_SUBDO Calmodulin OS=Suberites domuncula PE=2 SV=3 44 194 2.0E-19
sp|P41041|CALM_PNECA Calmodulin OS=Pneumocystis carinii PE=3 SV=1 44 194 2.0E-19
sp|P69098|CALM_TRYBG Calmodulin OS=Trypanosoma brucei gambiense PE=3 SV=2 44 194 2.0E-19
sp|P69097|CALM_TRYBB Calmodulin OS=Trypanosoma brucei brucei PE=3 SV=2 44 194 2.0E-19
sp|Q9XZP2|CALM2_BRAFL Calmodulin-2 OS=Branchiostoma floridae GN=CAM2 PE=2 SV=4 44 194 2.0E-19
sp|P18061|CALM_TRYCR Calmodulin OS=Trypanosoma cruzi GN=CALA2 PE=3 SV=2 44 194 2.0E-19
sp|P80164|MLR_LUMTE Myosin regulatory light chain, striated muscle, 25 kDa isoform OS=Lumbricus terrestris PE=1 SV=1 36 199 3.0E-19
sp|P05932|CALMB_ARBPU Calmodulin-beta (Fragment) OS=Arbacia punctulata PE=2 SV=1 47 194 3.0E-19
sp|P48976|CALM_MALDO Calmodulin OS=Malus domestica GN=CAM PE=3 SV=2 44 194 3.0E-19
sp|P04112|MLRB_MIZYE Myosin regulatory light chain B, smooth adductor muscle OS=Mizuhopecten yessoensis PE=1 SV=1 29 195 4.0E-19
sp|Q6R520|CALM_OREMO Calmodulin OS=Oreochromis mossambicus GN=calm PE=2 SV=3 44 194 4.0E-19
sp|P61859|CALM_NEUCR Calmodulin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cmd-1 PE=1 SV=2 44 194 4.0E-19
sp|Q9UWF0|CALM_MAGO7 Calmodulin OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CMD1 PE=3 SV=4 44 194 4.0E-19
sp|P61860|CALM_COLTR Calmodulin OS=Colletotrichum trifolii PE=3 SV=2 44 194 4.0E-19
sp|P61861|CALM_COLGL Calmodulin OS=Colletotrichum gloeosporioides PE=2 SV=2 44 194 4.0E-19
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 44 190 5.0E-19
sp|P27482|CALL3_HUMAN Calmodulin-like protein 3 OS=Homo sapiens GN=CALML3 PE=1 SV=2 44 194 5.0E-19
sp|P05933|CALM_SCHPO Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam1 PE=1 SV=1 44 194 5.0E-19
sp|Q9LIK5|CML11_ARATH Calmodulin-like protein 11 OS=Arabidopsis thaliana GN=CML11 PE=2 SV=1 44 197 6.0E-19
sp|Q9HFY6|CALM_BLAEM Calmodulin OS=Blastocladiella emersonii GN=CMD1 PE=3 SV=3 44 194 6.0E-19
sp|P13868|CALM1_SOLTU Calmodulin-1 OS=Solanum tuberosum GN=PCM1 PE=1 SV=2 44 194 8.0E-19
sp|Q9UUG5|MLR1_SCHPO Myosin regulatory light chain 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rlc1 PE=1 SV=1 29 194 9.0E-19
sp|P60204|CALM_EMENI Calmodulin OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=camA PE=3 SV=2 44 194 9.0E-19
sp|P60205|CALM_ASPOR Calmodulin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cmdA PE=3 SV=2 44 194 9.0E-19
sp|P60206|CALM_AJECG Calmodulin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CAM1 PE=2 SV=2 44 194 9.0E-19
sp|P07461|MLR_HALRO Myosin regulatory light chain, smooth muscle OS=Halocynthia roretzi PE=1 SV=1 33 199 1.0E-18
sp|Q39752|CALM_FAGSY Calmodulin OS=Fagus sylvatica GN=CAMF1 PE=2 SV=3 44 194 1.0E-18
sp|P27161|CALM_SOLLC Calmodulin OS=Solanum lycopersicum GN=CALM1 PE=2 SV=2 44 194 1.0E-18
sp|P27163|CALM2_PETHY Calmodulin-2 OS=Petunia hybrida GN=CAM72 PE=2 SV=2 44 194 1.0E-18
sp|P02597|CALMS_CHICK Calmodulin, striated muscle OS=Gallus gallus GN=CCM1 PE=3 SV=2 44 194 2.0E-18
sp|P04466|MLRS_RAT Myosin regulatory light chain 2, skeletal muscle isoform OS=Rattus norvegicus GN=Mylpf PE=1 SV=2 22 194 3.0E-18
sp|P02608|MLRS_RABIT Myosin regulatory light chain 2, skeletal muscle isoform type 2 OS=Oryctolagus cuniculus GN=MYLPF PE=1 SV=3 22 194 3.0E-18
sp|P19626|MLR2_CAEEL Myosin regulatory light chain 2 OS=Caenorhabditis elegans GN=mlc-2 PE=3 SV=1 40 200 3.0E-18
sp|P97457|MLRS_MOUSE Myosin regulatory light chain 2, skeletal muscle isoform OS=Mus musculus GN=Mylpf PE=1 SV=3 22 194 3.0E-18
sp|Q1HPS0|MLR_BOMMO Myosin regulatory light chain 2 OS=Bombyx mori PE=1 SV=1 28 194 3.0E-18
sp|O82018|CALM_MOUSC Calmodulin OS=Mougeotia scalaris PE=2 SV=3 44 194 4.0E-18
sp|P19625|MLR1_CAEEL Myosin regulatory light chain 1 OS=Caenorhabditis elegans GN=mlc-1 PE=3 SV=1 40 200 5.0E-18
sp|Q40642|CML1_ORYSI Calmodulin-like protein 1 OS=Oryza sativa subsp. indica GN=CML1 PE=1 SV=1 44 194 6.0E-18
sp|P08052|MLR_TODPA Myosin regulatory light chain LC-2, mantle muscle OS=Todarodes pacificus PE=1 SV=1 44 193 7.0E-18
sp|P24732|MLRT_RABIT Myosin regulatory light chain 2, skeletal muscle isoform type 1 OS=Oryctolagus cuniculus PE=2 SV=2 22 194 7.0E-18
sp|P05419|CALN_CHICK Neo-calmodulin (Fragment) OS=Gallus gallus PE=2 SV=1 47 190 8.0E-18
sp|Q8S1Y9|CML1_ORYSJ Calmodulin-like protein 1 OS=Oryza sativa subsp. japonica GN=CML1 PE=2 SV=1 44 194 9.0E-18
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 44 194 1.0E-17
sp|P05944|MLRC_MIZYE Myosin regulatory light chain, striated adductor muscle OS=Mizuhopecten yessoensis PE=1 SV=1 29 195 2.0E-17
sp|Q0P571|MLRS_BOVIN Myosin regulatory light chain 2, skeletal muscle isoform OS=Bos taurus GN=MYLPF PE=2 SV=1 22 194 2.0E-17
sp|P08051|MLR_SPISA Myosin regulatory light chain, smooth muscle OS=Spisula sachalinensis PE=1 SV=1 24 200 4.0E-17
sp|Q96A32|MLRS_HUMAN Myosin regulatory light chain 2, skeletal muscle isoform OS=Homo sapiens GN=MYLPF PE=2 SV=1 22 194 1.0E-16
sp|P13543|MLR_ARGIR Myosin regulatory light chain, striated adductor muscle OS=Argopecten irradians PE=1 SV=3 29 195 2.0E-16
sp|P18432|MLR_DROME Myosin regulatory light chain 2 OS=Drosophila melanogaster GN=Mlc2 PE=1 SV=2 19 194 2.0E-16
sp|P05963|MLR_CHLNI Myosin regulatory light chain, striated adductor muscle OS=Chlamys nipponensis akazara PE=1 SV=1 29 195 9.0E-16
sp|P14533|CABO_DORPE Squidulin OS=Doryteuthis pealeii PE=1 SV=1 44 194 1.0E-15
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 44 194 2.0E-15
sp|Q0IQB6|CML3_ORYSJ Calmodulin-like protein 3 OS=Oryza sativa subsp. japonica GN=CML3 PE=2 SV=1 44 194 4.0E-15
sp|P02613|MLR_PATSP Myosin regulatory light chain OS=Patinopecten sp. PE=1 SV=1 29 195 7.0E-15
sp|Q2R1Z5|CML6_ORYSJ Putative calmodulin-like protein 6 OS=Oryza sativa subsp. japonica GN=CML6 PE=3 SV=1 38 194 1.0E-14
sp|Q7DMP0|CALM2_SOLTU Calmodulin-2/4 (Fragment) OS=Solanum tuberosum GN=PCM2 PE=2 SV=1 61 194 2.0E-13
sp|Q84MN0|CML4_ORYSJ Calmodulin-like protein 4 OS=Oryza sativa subsp. japonica GN=CML4 PE=2 SV=1 44 195 3.0E-13
sp|Q9S744|CML9_ARATH Calmodulin-like protein 9 OS=Arabidopsis thaliana GN=CML9 PE=1 SV=1 40 194 3.0E-13
sp|Q41420|CALM3_SOLTU Putative calmodulin-3 (Fragment) OS=Solanum tuberosum GN=PCM3 PE=5 SV=1 61 194 9.0E-13
sp|Q5XGC7|CALL4_XENTR Calmodulin-like protein 4 OS=Xenopus tropicalis GN=calml4 PE=2 SV=1 45 192 1.0E-12
sp|P04630|CALL_CAEEL Calmodulin-like protein OS=Caenorhabditis elegans GN=cal-1 PE=3 SV=1 36 194 1.0E-12
sp|P53441|CATR_NAEGR Caltractin OS=Naegleria gruberi GN=CTN PE=2 SV=1 44 195 2.0E-12
sp|P49258|CALL_DROME Calmodulin-related protein 97A OS=Drosophila melanogaster GN=Acam PE=1 SV=2 44 191 3.0E-12
sp|Q2TBN3|CETN2_BOVIN Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1 44 195 3.0E-12
sp|Q9R1K9|CETN2_MOUSE Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1 44 195 5.0E-12
sp|P41209|CETN1_MOUSE Centrin-1 OS=Mus musculus GN=Cetn1 PE=1 SV=1 44 195 1.0E-11
sp|Q7Z2B8|MLCD_DICDI Myosin-ID light chain OS=Dictyostelium discoideum GN=mlcD PE=1 SV=1 47 192 1.0E-11
sp|Q12798|CETN1_HUMAN Centrin-1 OS=Homo sapiens GN=CETN1 PE=1 SV=1 44 195 2.0E-11
sp|Q948R0|CML5_ORYSJ Calmodulin-like protein 5 OS=Oryza sativa subsp. japonica GN=CML5 PE=2 SV=1 44 199 4.0E-11
sp|P41208|CETN2_HUMAN Centrin-2 OS=Homo sapiens GN=CETN2 PE=1 SV=1 24 195 4.0E-11
sp|O00897|CALML_DICDI Calmodulin-like protein OS=Dictyostelium discoideum GN=calB PE=2 SV=1 48 195 7.0E-11
sp|Q06827|CATR_SCHDU Caltractin OS=Scherffelia dubia PE=1 SV=1 29 195 9.0E-11
sp|P05434|CATR_CHLRE Caltractin OS=Chlamydomonas reinhardtii PE=1 SV=1 22 195 9.0E-11
sp|Q32LE3|CETN1_BOVIN Centrin-1 OS=Bos taurus GN=CETN1 PE=2 SV=1 7 195 1.0E-10
sp|P30187|CML10_ARATH Calmodulin-like protein 10 OS=Arabidopsis thaliana GN=CML10 PE=2 SV=1 40 194 1.0E-10
sp|P02589|TNNC2_PELES Troponin C, skeletal muscle OS=Pelophylax esculentus PE=1 SV=1 22 194 2.0E-10
sp|P02606|MLEC_CHICK Myosin light chain 1, cardiac muscle OS=Gallus gallus PE=1 SV=3 33 197 2.0E-10
sp|P54213|CATR_DUNSA Caltractin OS=Dunaliella salina PE=2 SV=1 21 195 3.0E-10
sp|P82160|MLE3_LIZRA Myosin light chain 3, skeletal muscle isoform OS=Liza ramada PE=1 SV=1 40 192 3.0E-10
sp|O82659|CML20_ARATH Probable calcium-binding protein CML20 OS=Arabidopsis thaliana GN=CML20 PE=1 SV=1 24 195 3.0E-10
sp|O14008|CAM2_SCHPO Myosin 1 light chain cam2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam2 PE=1 SV=1 44 192 5.0E-10
sp|Q9N1Q9|CABP2_BOVIN Calcium-binding protein 2 OS=Bos taurus GN=CABP2 PE=2 SV=3 40 194 5.0E-10
sp|P43645|CATR_SPESI Caltractin (Fragment) OS=Spermatozopsis similis PE=2 SV=1 44 195 6.0E-10
sp|P82159|MLE1_LIZRA Myosin light chain 1, skeletal muscle isoform OS=Liza ramada PE=1 SV=1 34 192 6.0E-10
sp|P54357|MLC2_DROME Myosin-2 essential light chain OS=Drosophila melanogaster GN=Mlc-c PE=1 SV=1 44 194 1.0E-09
sp|P43646|CATR_TETST Caltractin (Fragment) OS=Tetraselmis striata PE=2 SV=1 44 195 1.0E-09
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 24 195 1.0E-09
sp|O74435|CDC31_SCHPO Cell division control protein 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc31 PE=1 SV=1 13 194 1.0E-09
sp|P80322|TNNC_BRALA Troponin C OS=Branchiostoma lanceolatum PE=1 SV=1 39 195 1.0E-09
sp|P81660|TNNC2_ANGAN Troponin C, skeletal muscle OS=Anguilla anguilla PE=1 SV=1 22 194 2.0E-09
sp|Q94AZ4|CML13_ARATH Probable calcium-binding protein CML13 OS=Arabidopsis thaliana GN=CML13 PE=2 SV=1 44 191 2.0E-09
sp|P13833|MLR_DICDI Myosin regulatory light chain OS=Dictyostelium discoideum GN=mlcR PE=2 SV=1 24 174 2.0E-09
sp|P02586|TNNC2_RABIT Troponin C, skeletal muscle OS=Oryctolagus cuniculus GN=TNNC2 PE=1 SV=2 38 194 2.0E-09
sp|Q9JLK4|CABP2_MOUSE Calcium-binding protein 2 OS=Mus musculus GN=Cabp2 PE=2 SV=3 40 194 2.0E-09
sp|P20801|TNNC2_MOUSE Troponin C, skeletal muscle OS=Mus musculus GN=Tnnc2 PE=1 SV=2 38 194 2.0E-09
sp|Q9JM83|CALM4_MOUSE Calmodulin-4 OS=Mus musculus GN=Calm4 PE=2 SV=2 40 193 2.0E-09
sp|P05934|CALM_STRPU Calmodulin (Fragment) OS=Strongylocentrotus purpuratus PE=2 SV=1 118 194 3.0E-09
sp|P02605|MLE3_CHICK Myosin light chain 3, skeletal muscle isoform OS=Gallus gallus PE=1 SV=3 40 192 3.0E-09
sp|Q8VZ50|CML14_ARATH Probable calcium-binding protein CML14 OS=Arabidopsis thaliana GN=CML14 PE=2 SV=1 44 191 4.0E-09
sp|P09541|MYL4_MOUSE Myosin light chain 4 OS=Mus musculus GN=Myl4 PE=1 SV=3 32 192 4.0E-09
sp|P02587|TNNC2_PIG Troponin C, skeletal muscle OS=Sus scrofa GN=TNNC2 PE=1 SV=2 38 194 4.0E-09
sp|P14649|MYL6B_HUMAN Myosin light chain 6B OS=Homo sapiens GN=MYL6B PE=1 SV=1 25 192 4.0E-09
sp|Q9CQ46|EFCB2_MOUSE EF-hand calcium-binding domain-containing protein 2 OS=Mus musculus GN=Efcab2 PE=1 SV=1 31 198 5.0E-09
sp|Q8K4K1|CETN4_MOUSE Centrin-4 OS=Mus musculus GN=Cetn4 PE=1 SV=1 40 195 5.0E-09
sp|Q17133|MLE_BRAFL Myosin, essential light chain OS=Branchiostoma floridae PE=2 SV=1 40 196 6.0E-09
sp|P02607|MYL6_CHICK Myosin light polypeptide 6 OS=Gallus gallus GN=MYL6 PE=1 SV=3 40 194 7.0E-09
sp|P16409|MYL3_RAT Myosin light chain 3 OS=Rattus norvegicus GN=Myl3 PE=1 SV=2 40 192 7.0E-09
sp|Q9NPB3|CABP2_HUMAN Calcium-binding protein 2 OS=Homo sapiens GN=CABP2 PE=1 SV=4 40 194 7.0E-09
sp|Q6F334|CML9_ORYSJ Probable calcium-binding protein CML9 OS=Oryza sativa subsp. japonica GN=CML9 PE=2 SV=1 44 197 8.0E-09
sp|P17209|MYL4_RAT Myosin light chain 4 OS=Rattus norvegicus GN=Myl4 PE=2 SV=2 32 192 9.0E-09
sp|Q8CI43|MYL6B_MOUSE Myosin light chain 6B OS=Mus musculus GN=Myl6b PE=1 SV=1 34 192 9.0E-09
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens GN=TNNC2 PE=1 SV=2 38 194 1.0E-08
sp|P07462|MLE_HALRO Myosin catalytic light chain, smooth muscle OS=Halocynthia roretzi PE=1 SV=1 40 194 2.0E-08
sp|Q84VG0|CML7_ORYSJ Probable calcium-binding protein CML7 OS=Oryza sativa subsp. japonica GN=CML7 PE=2 SV=1 44 192 2.0E-08
sp|Q6L5F4|CML14_ORYSJ Probable calcium-binding protein CML14 OS=Oryza sativa subsp. japonica GN=CML14 PE=2 SV=1 43 194 2.0E-08
sp|P10246|TNNC2_MELGA Troponin C, skeletal muscle OS=Meleagris gallopavo GN=TNNC2 PE=1 SV=2 45 194 3.0E-08
sp|Q9NZU7|CABP1_HUMAN Calcium-binding protein 1 OS=Homo sapiens GN=CABP1 PE=1 SV=5 40 194 3.0E-08
sp|O88751|CABP1_RAT Calcium-binding protein 1 OS=Rattus norvegicus GN=Cabp1 PE=1 SV=2 40 194 3.0E-08
sp|P06706|TNNC_HALRO Troponin C, body wall muscle OS=Halocynthia roretzi PE=1 SV=2 47 195 3.0E-08
sp|Q9N1Q8|CABP5_BOVIN Calcium-binding protein 5 OS=Bos taurus GN=CABP5 PE=1 SV=1 23 194 3.0E-08
sp|P05976|MYL1_HUMAN Myosin light chain 1/3, skeletal muscle isoform OS=Homo sapiens GN=MYL1 PE=2 SV=3 40 192 4.0E-08
sp|P53141|MLC1_YEAST Myosin light chain 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLC1 PE=1 SV=1 49 195 7.0E-08
sp|P02600|MYL1_RAT Myosin light chain 1/3, skeletal muscle isoform OS=Rattus norvegicus GN=Myl1 PE=1 SV=2 40 192 7.0E-08
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 24 195 7.0E-08
sp|Q09196|MLR4_SCHPO Myosin regulatory light chain cdc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc4 PE=1 SV=1 48 197 7.0E-08
sp|Q9N1R0|CABP1_BOVIN Calcium-binding protein 1 OS=Bos taurus GN=CABP1 PE=1 SV=3 40 194 8.0E-08
sp|Q64119|MYL6_RAT Myosin light polypeptide 6 OS=Rattus norvegicus GN=Myl6 PE=1 SV=3 40 194 8.0E-08
sp|Q9JLK7|CABP1_MOUSE Calcium-binding protein 1 OS=Mus musculus GN=Cabp1 PE=1 SV=3 40 194 8.0E-08
sp|P09542|MYL3_MOUSE Myosin light chain 3 OS=Mus musculus GN=Myl3 PE=1 SV=4 40 192 8.0E-08
sp|P02602|MYL1_RABIT Myosin light chain 1/3, skeletal muscle isoform OS=Oryctolagus cuniculus GN=MYL1 PE=1 SV=3 40 192 1.0E-07
sp|Q9LQN4|CML17_ARATH Probable calcium-binding protein CML17 OS=Arabidopsis thaliana GN=CML17 PE=2 SV=1 44 194 1.0E-07
sp|P09540|MLEX_CHICK Myosin light chain, embryonic OS=Gallus gallus PE=2 SV=1 32 192 1.0E-07
sp|P02588|TNNC2_CHICK Troponin C, skeletal muscle OS=Gallus gallus GN=TNNC2 PE=1 SV=3 45 194 1.0E-07
sp|Q5R844|MYL6_PONAB Myosin light polypeptide 6 OS=Pongo abelii GN=MYL6 PE=2 SV=3 40 192 1.0E-07
sp|P60662|MYL6_PIG Myosin light polypeptide 6 OS=Sus scrofa GN=MYL6 PE=1 SV=2 40 192 1.0E-07
sp|Q60605|MYL6_MOUSE Myosin light polypeptide 6 OS=Mus musculus GN=Myl6 PE=1 SV=3 40 192 1.0E-07
sp|P60660|MYL6_HUMAN Myosin light polypeptide 6 OS=Homo sapiens GN=MYL6 PE=1 SV=2 40 192 1.0E-07
sp|P60661|MYL6_BOVIN Myosin light polypeptide 6 OS=Bos taurus GN=MYL6 PE=2 SV=2 40 192 1.0E-07
sp|P05977|MYL1_MOUSE Myosin light chain 1/3, skeletal muscle isoform OS=Mus musculus GN=Myl1 PE=1 SV=2 40 192 2.0E-07
sp|P85100|MYL3_BOVIN Myosin light chain 3 OS=Bos taurus GN=MYL3 PE=1 SV=1 32 192 2.0E-07
sp|Q3SB11|CALGL_TROCA Calglandulin OS=Tropidechis carinatus PE=2 SV=1 38 194 2.0E-07
sp|A0JNJ5|MYL1_BOVIN Myosin light chain 1/3, skeletal muscle isoform OS=Bos taurus GN=MYL1 PE=2 SV=1 40 197 2.0E-07
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 44 207 2.0E-07
sp|Q9NZT1|CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 40 194 2.0E-07
sp|Q3SB13|CALGL_PSETE Calglandulin OS=Pseudonaja textilis PE=2 SV=1 38 194 2.0E-07
sp|Q3SB08|CALGL_PSEPO Calglandulin OS=Pseudechis porphyriacus PE=2 SV=1 38 194 2.0E-07
sp|Q3SB09|CALGL_PSEAU Calglandulin OS=Pseudechis australis PE=2 SV=1 38 194 2.0E-07
sp|Q3SB15|CALGL_OXYSC Calglandulin OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 38 194 2.0E-07
sp|Q3SB14|CALGL_OXYMI Calglandulin OS=Oxyuranus microlepidotus PE=2 SV=1 38 194 2.0E-07
sp|Q3SB12|CALGL_NOTSC Calglandulin OS=Notechis scutatus scutatus PE=2 SV=1 38 194 2.0E-07
sp|Q3SB10|CALGL_HOPST Calglandulin OS=Hoplocephalus stephensii PE=2 SV=1 38 194 2.0E-07
sp|Q9NP86|CABP5_HUMAN Calcium-binding protein 5 OS=Homo sapiens GN=CABP5 PE=1 SV=1 44 194 2.0E-07
sp|Q27177|CATR1_PARTE Caltractin ICL1a OS=Paramecium tetraurelia GN=Icl1a PE=1 SV=2 44 194 3.0E-07
sp|P12829|MYL4_HUMAN Myosin light chain 4 OS=Homo sapiens GN=MYL4 PE=1 SV=3 32 192 3.0E-07
sp|Q06580|MLC2_YEAST Myosin light chain 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MLC2 PE=1 SV=1 34 141 4.0E-07
sp|Q27179|CATR2_PARTE Caltractin ICL1b OS=Paramecium tetraurelia GN=Icl1b PE=3 SV=2 44 194 6.0E-07
sp|Q27178|CATR3_PARTE Caltractin ICL1c OS=Paramecium tetraurelia GN=Icl1c PE=3 SV=1 44 194 6.0E-07
sp|Q94726|CATR4_PARTE Caltractin ICL1d OS=Paramecium tetraurelia GN=Icl1d PE=3 SV=1 44 194 6.0E-07
sp|Q8AY75|CALGL_BOTIN Calglandulin OS=Bothrops insularis PE=2 SV=1 38 194 7.0E-07
sp|Q7F0J0|CML13_ORYSJ Probable calcium-binding protein CML13 OS=Oryza sativa subsp. japonica GN=CML13 PE=2 SV=1 26 195 9.0E-07
sp|P02604|MLE1_CHICK Myosin light chain 1, skeletal muscle isoform OS=Gallus gallus PE=1 SV=3 40 192 1.0E-06
sp|O35648|CETN3_MOUSE Centrin-3 OS=Mus musculus GN=Cetn3 PE=1 SV=1 26 194 1.0E-06
sp|P08053|MLR_PHYPO Myosin regulatory light chain OS=Physarum polycephalum PE=1 SV=1 43 194 1.0E-06
sp|O15182|CETN3_HUMAN Centrin-3 OS=Homo sapiens GN=CETN3 PE=1 SV=2 26 194 2.0E-06
sp|Q9LNE7|CML7_ARATH Calmodulin-like protein 7 OS=Arabidopsis thaliana GN=CML7 PE=2 SV=1 47 195 2.0E-06
sp|Q9JLK3|CABP5_MOUSE Calcium-binding protein 5 OS=Mus musculus GN=Cabp5 PE=1 SV=1 44 194 3.0E-06
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 44 208 3.0E-06
sp|Q5VUJ9|EFCB2_HUMAN EF-hand calcium-binding domain-containing protein 2 OS=Homo sapiens GN=EFCAB2 PE=2 SV=1 46 160 4.0E-06
sp|Q3SEK2|CATR6_PARTE Caltractin ICL1f OS=Paramecium tetraurelia GN=Icl1f PE=3 SV=1 44 194 4.0E-06
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 44 195 5.0E-06
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 44 208 5.0E-06
sp|Q6P1E8|EFCB6_MOUSE EF-hand calcium-binding domain-containing protein 6 OS=Mus musculus GN=Efcab6 PE=1 SV=2 48 196 5.0E-06
sp|Q9FZ75|CML15_ARATH Probable calcium-binding protein CML15 OS=Arabidopsis thaliana GN=CML15 PE=2 SV=1 44 194 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5948 0.5693 0.0245 0.0634 0.1835 0.0076 0.2105 0.088 0.0825 0.0234

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup3052
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|003180
Agaricus bisporus var bisporus H97 AgabiH97|003180 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|35_45

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|003180
MSRYPDYLSPNITPTKLGGGFPKSQKSRARREPSGVFSLFQPAQIQQFKEAFQLIDHDKDGWVSEADLKEIFSSL
GITPSKKMMDELLNSRPGGQSRGDAFGGNSESSDRGVNFTMFLTMMSERLFEFDVESELVEAFECFDENDSGIVK
ADEMKKWLSEVAERMDSWEIDRFLKGPFMDRQGNFNYREWVKVLRVNEENGEGQQQQL*
Coding >AgabiH97|003180
ATGTCACGATATCCTGACTATTTATCGCCTAACATAACGCCAACTAAACTAGGTGGCGGGTTTCCAAAATCTCAG
AAGTCGCGCGCAAGACGTGAACCATCTGGCGTGTTTTCCTTATTCCAACCGGCACAAATTCAGCAATTCAAGGAG
GCGTTTCAATTAATCGATCATGATAAGGATGGATGGGTTAGTGAAGCAGATTTGAAGGAGATTTTCTCTAGCTTA
GGTATCACGCCATCCAAGAAGATGATGGATGAACTTTTGAATTCAAGACCTGGTGGTCAATCGCGTGGAGACGCG
TTTGGTGGAAATTCCGAGTCGAGCGATCGTGGTGTCAACTTTACGATGTTCTTGACCATGATGAGTGAACGACTG
TTTGAATTCGATGTAGAGTCAGAGTTGGTGGAAGCATTTGAATGTTTCGACGAAAACGATTCAGGTATCGTCAAG
GCTGATGAAATGAAGAAATGGTTAAGCGAAGTAGCTGAAAGGATGGATAGTTGGGAGATCGATAGGTTTCTCAAG
GGCCCTTTCATGGACCGACAAGGGAATTTTAACTATCGGGAATGGGTTAAAGTATTACGAGTGAATGAAGAAAAC
GGGGAAGGCCAGCAACAACAACTCTGA
Transcript >AgabiH97|003180
ATGTCACGATATCCTGACTATTTATCGCCTAACATAACGCCAACTAAACTAGGTGGCGGGTTTCCAAAATCTCAG
AAGTCGCGCGCAAGACGTGAACCATCTGGCGTGTTTTCCTTATTCCAACCGGCACAAATTCAGCAATTCAAGGAG
GCGTTTCAATTAATCGATCATGATAAGGATGGATGGGTTAGTGAAGCAGATTTGAAGGAGATTTTCTCTAGCTTA
GGTATCACGCCATCCAAGAAGATGATGGATGAACTTTTGAATTCAAGACCTGGTGGTCAATCGCGTGGAGACGCG
TTTGGTGGAAATTCCGAGTCGAGCGATCGTGGTGTCAACTTTACGATGTTCTTGACCATGATGAGTGAACGACTG
TTTGAATTCGATGTAGAGTCAGAGTTGGTGGAAGCATTTGAATGTTTCGACGAAAACGATTCAGGTATCGTCAAG
GCTGATGAAATGAAGAAATGGTTAAGCGAAGTAGCTGAAAGGATGGATAGTTGGGAGATCGATAGGTTTCTCAAG
GGCCCTTTCATGGACCGACAAGGGAATTTTAACTATCGGGAATGGGTTAAAGTATTACGAGTGAATGAAGAAAAC
GGGGAAGGCCAGCAACAACAACTCTGA
Gene >AgabiH97|003180
ATGTCACGATATCCTGACTATTTATCGCCTAACATAACGCCAACTAAACTAGGTGGCGGGTTTCCAAAATCTCAG
AAGTCGCGCGCAAGACGTGAACCATCTGGCGTGTTTTCCTTATTCCAACCGGCACAAATTCAGCAATTCAAGGAG
GCGTTTCAATTAATCGATCATGATAAGGATGGATGGGTTAGTGAAGCAGATTTGAAGGAGATTTTCTCTAGCTTA
GGTGAGTGTTTAAACGTTTACTTAAAACTCTGATCTGAGGTGTATTTCGAAGGTATCACGCCATCCAAGAAGATG
ATGGATGAACTTTTGAATTCAAGACCTGGTGGTCAATCGCGTGGAGACGCGTTTGGTGGAAATTCCGAGTCGAGC
GATCGTGGTGTCAACTTTACGATGTTCTTGACCATGATGAGTGAACGACTGTTTGAATTCGATGTAGAGTCAGAG
TTGGTGGAAGCATTTGAATGTTTCGACGAAAACGATTCAGGTATCGTCAAGGCTGATGAAATGAAGAAATGGTTA
AGCGAAGTAGCTGAAAGGATGGATAGTTGGGAGGTTAGTATCGAATGCCCTCCTCTACAGCGCCATCAGAGAACT
GAAAGCCGTATTTAGATCGATAGGTTTCTCAAGGGCCCTTTCATGGACCGACAAGGGAATTTTAACTATCGGGAA
TGGGTTAAAGTATTACGAGTGAATGAAGAAAACGGGGAAGGCCAGCAACAACAACTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail