Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|003070
Gene name
Locationscaffold_1:783210..785503
Strand-
Gene length (bp)2293
Transcript length (bp)1959
Coding sequence length (bp)1959
Protein length (aa) 653

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.3E-08 3 62
PF00023 Ank Ankyrin repeat 9.6E-04 36 62
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 2.9E-05 170 188
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 2.7E-01 397 414
PF13606 Ank_3 Ankyrin repeat 9.8E-04 36 62
PF13637 Ank_4 Ankyrin repeats (many copies) 1.1E-04 4 56

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|003070
MAFPLLKACSEGNLHVVSDLLHGSNPVDIEFRDESGSTPLIEAVKNGHVNIIHALLEKGADPSNGSPEQHTTDQV
ILGLLAQAKNKPLQDGVSGPESSYLRDGSDDSQKPFYPPPPPDAYPYYPTINPSLSTVPDGGVYYPPPLPPHMGG
NHSPGGPHHLPPPEVARMIPCRYYPACRYGPSCIFLHPPQGYYPNGAPPPAPYPHYDPMGAPPFSPNFYPPPTYQ
QANGPLPMTPLSPPPGPPHIVHARSTSEIVSPTQGHFSPNGVSPPVPYGPMSPSYPHSAPMPVPLSGPPVPPLHH
QPQPQLPPPGPQSPTNFSPSPVGPFNVQPDGPAMYPQQQPSLSNGNVSFAPEVDGMPKPQPGAEGFVNGVPHPHT
RDVPMHARRSSRRASFGKPKPPCLFFPTGRCKNGDDCRFPHIMPDGTSASTNHHAPFYAGRGGGPRQPRGQFLHN
GLEEKFNNMNIRDESQIQQNGVDVASKSLNTANDNGPVVNTRPRFPPSGKHHQHHPHHGFNPQHNHYNGKLQKLN
VQGNMKQRVPNADDFPVLAGTITPPSKSPLTVNGPTAAQILQAPAPMRKEVSSLINGKEASTRGTTPERSRSPSI
KDSPQYQDNGVPDDNVSSEPPANKLPVSFAAAATAAKGSAAPDIAKEVSVSA*
Coding >AgabiH97|003070
ATGGCCTTTCCTCTCCTCAAGGCTTGTTCTGAGGGCAACCTCCACGTCGTCAGCGATCTCCTCCACGGCTCCAAT
CCAGTTGATATTGAATTTAGAGACGAGTCCGGGTCCACTCCCCTCATTGAGGCCGTCAAAAATGGTCACGTCAAC
ATCATCCATGCTCTTCTCGAAAAAGGCGCCGATCCGTCTAACGGTTCTCCTGAGCAGCACACGACTGACCAGGTC
ATCCTAGGCCTACTGGCACAGGCAAAAAACAAACCTCTCCAGGATGGCGTCTCTGGTCCCGAATCATCGTACCTC
CGTGATGGGAGTGACGATTCCCAAAAGCCTTTCTACCCTCCCCCTCCTCCGGACGCATACCCTTATTATCCCACT
ATCAATCCTTCCCTTTCTACTGTCCCCGATGGAGGTGTCTATTACCCTCCTCCCCTTCCTCCGCACATGGGTGGA
AACCACTCACCAGGGGGTCCACACCATCTTCCTCCCCCCGAGGTAGCTCGTATGATTCCATGTCGATACTACCCC
GCCTGTCGTTATGGTCCTTCGTGCATTTTTTTGCATCCCCCTCAAGGTTATTATCCCAACGGTGCTCCGCCCCCT
GCACCTTACCCTCATTATGACCCCATGGGTGCTCCTCCTTTCTCTCCCAACTTTTACCCGCCGCCCACCTACCAG
CAGGCTAATGGTCCGCTTCCCATGACGCCTCTTTCCCCACCACCTGGCCCTCCCCATATCGTACACGCTAGGTCA
ACATCAGAAATTGTCTCGCCTACCCAAGGGCACTTTAGTCCGAATGGGGTTTCGCCTCCCGTACCGTATGGACCC
ATGTCACCTTCATACCCTCATTCTGCGCCAATGCCAGTCCCACTTTCGGGTCCCCCCGTACCCCCACTCCACCAT
CAACCACAGCCTCAACTTCCCCCTCCCGGGCCCCAGTCACCTACGAATTTTTCGCCTTCGCCCGTAGGTCCCTTC
AATGTTCAACCGGATGGTCCCGCCATGTATCCTCAACAGCAACCATCATTGTCCAATGGGAACGTAAGCTTTGCG
CCGGAGGTTGATGGCATGCCCAAGCCTCAACCTGGGGCCGAAGGTTTTGTTAACGGTGTTCCTCATCCTCATACT
CGCGATGTACCCATGCATGCTCGTCGGAGTAGTCGACGCGCTTCCTTCGGGAAGCCTAAACCTCCTTGTCTTTTC
TTCCCCACCGGGAGGTGTAAAAATGGTGACGACTGTCGGTTCCCCCATATCATGCCCGACGGCACTAGTGCATCT
ACAAATCATCATGCACCTTTCTATGCAGGGAGGGGAGGTGGTCCCAGACAGCCACGTGGTCAGTTCCTACATAAT
GGCTTGGAAGAAAAGTTCAATAATATGAACATTCGAGATGAATCCCAGATCCAACAAAATGGCGTCGATGTTGCG
TCAAAATCTTTGAACACCGCCAATGACAATGGACCAGTTGTCAATACTCGTCCTCGATTTCCGCCTAGTGGTAAA
CACCATCAACACCACCCTCATCACGGCTTCAACCCACAGCACAACCATTATAACGGAAAGTTGCAAAAATTGAAT
GTGCAAGGGAACATGAAGCAACGTGTGCCGAATGCTGACGATTTCCCTGTTCTCGCTGGAACCATCACACCGCCT
TCGAAGAGCCCCTTGACAGTAAATGGACCGACTGCTGCTCAAATCCTACAAGCACCGGCACCTATGAGGAAAGAG
GTCTCGTCGCTTATCAATGGAAAAGAAGCTAGCACGCGTGGGACAACTCCTGAACGATCTCGGTCGCCTAGCATA
AAGGATTCCCCGCAATATCAGGACAACGGAGTTCCTGATGATAATGTTTCTTCTGAGCCCCCCGCCAATAAACTT
CCTGTCTCATTCGCGGCTGCAGCTACTGCAGCCAAGGGATCTGCAGCACCAGATATTGCAAAAGAGGTGTCTGTC
TCTGCCTAG
Transcript >AgabiH97|003070
ATGGCCTTTCCTCTCCTCAAGGCTTGTTCTGAGGGCAACCTCCACGTCGTCAGCGATCTCCTCCACGGCTCCAAT
CCAGTTGATATTGAATTTAGAGACGAGTCCGGGTCCACTCCCCTCATTGAGGCCGTCAAAAATGGTCACGTCAAC
ATCATCCATGCTCTTCTCGAAAAAGGCGCCGATCCGTCTAACGGTTCTCCTGAGCAGCACACGACTGACCAGGTC
ATCCTAGGCCTACTGGCACAGGCAAAAAACAAACCTCTCCAGGATGGCGTCTCTGGTCCCGAATCATCGTACCTC
CGTGATGGGAGTGACGATTCCCAAAAGCCTTTCTACCCTCCCCCTCCTCCGGACGCATACCCTTATTATCCCACT
ATCAATCCTTCCCTTTCTACTGTCCCCGATGGAGGTGTCTATTACCCTCCTCCCCTTCCTCCGCACATGGGTGGA
AACCACTCACCAGGGGGTCCACACCATCTTCCTCCCCCCGAGGTAGCTCGTATGATTCCATGTCGATACTACCCC
GCCTGTCGTTATGGTCCTTCGTGCATTTTTTTGCATCCCCCTCAAGGTTATTATCCCAACGGTGCTCCGCCCCCT
GCACCTTACCCTCATTATGACCCCATGGGTGCTCCTCCTTTCTCTCCCAACTTTTACCCGCCGCCCACCTACCAG
CAGGCTAATGGTCCGCTTCCCATGACGCCTCTTTCCCCACCACCTGGCCCTCCCCATATCGTACACGCTAGGTCA
ACATCAGAAATTGTCTCGCCTACCCAAGGGCACTTTAGTCCGAATGGGGTTTCGCCTCCCGTACCGTATGGACCC
ATGTCACCTTCATACCCTCATTCTGCGCCAATGCCAGTCCCACTTTCGGGTCCCCCCGTACCCCCACTCCACCAT
CAACCACAGCCTCAACTTCCCCCTCCCGGGCCCCAGTCACCTACGAATTTTTCGCCTTCGCCCGTAGGTCCCTTC
AATGTTCAACCGGATGGTCCCGCCATGTATCCTCAACAGCAACCATCATTGTCCAATGGGAACGTAAGCTTTGCG
CCGGAGGTTGATGGCATGCCCAAGCCTCAACCTGGGGCCGAAGGTTTTGTTAACGGTGTTCCTCATCCTCATACT
CGCGATGTACCCATGCATGCTCGTCGGAGTAGTCGACGCGCTTCCTTCGGGAAGCCTAAACCTCCTTGTCTTTTC
TTCCCCACCGGGAGGTGTAAAAATGGTGACGACTGTCGGTTCCCCCATATCATGCCCGACGGCACTAGTGCATCT
ACAAATCATCATGCACCTTTCTATGCAGGGAGGGGAGGTGGTCCCAGACAGCCACGTGGTCAGTTCCTACATAAT
GGCTTGGAAGAAAAGTTCAATAATATGAACATTCGAGATGAATCCCAGATCCAACAAAATGGCGTCGATGTTGCG
TCAAAATCTTTGAACACCGCCAATGACAATGGACCAGTTGTCAATACTCGTCCTCGATTTCCGCCTAGTGGTAAA
CACCATCAACACCACCCTCATCACGGCTTCAACCCACAGCACAACCATTATAACGGAAAGTTGCAAAAATTGAAT
GTGCAAGGGAACATGAAGCAACGTGTGCCGAATGCTGACGATTTCCCTGTTCTCGCTGGAACCATCACACCGCCT
TCGAAGAGCCCCTTGACAGTAAATGGACCGACTGCTGCTCAAATCCTACAAGCACCGGCACCTATGAGGAAAGAG
GTCTCGTCGCTTATCAATGGAAAAGAAGCTAGCACGCGTGGGACAACTCCTGAACGATCTCGGTCGCCTAGCATA
AAGGATTCCCCGCAATATCAGGACAACGGAGTTCCTGATGATAATGTTTCTTCTGAGCCCCCCGCCAATAAACTT
CCTGTCTCATTCGCGGCTGCAGCTACTGCAGCCAAGGGATCTGCAGCACCAGATATTGCAAAAGAGGTGTCTGTC
TCTGCCTAG
Gene >AgabiH97|003070
ATGGCCTTTCCTCTCCTCAAGGCTTGTTCTGAGGGCAACCTCCACGTCGTCAGCGATCTCCTCCACGGCTCCAAT
CCAGTTGATATTGAATTTAGAGGTTCGTCATCGCTCTCCTTTTGTTGTATCCTTCTCACTGTCCTCGCCACTTTT
GCAGACGAGTCCGGGTCCACTCCCCTCATTGAGGCCGTCAAAAATGGTCACGTCAACATCATCCATGCTCTTCTC
GAAAAAGGTATGTCTCTGACTCATTCCTCATGTGAGATGTTCCCTGATCACCTTCCAACCCCAGGCGCCGATCCG
TCTAACGGTTCTCCTGAGCAGCACACGACTGACCAGGTCATCCTAGGCCTACTGGCACAGGCAAAAAACAAACCT
CTCCAGGATGGCGTCTCTGGTCCCGAATCATCGTACCTCCGTGATGGGAGTGACGATTCCCAAAAGCCTTTCTAC
CCTCCCCCTCCTCCGGACGCATACCCTTATTATCCCACTATCAATCCTTCCCTTTCTACTGTCCCCGATGGAGGT
GTCTATTACCCTCCTCCCCTTCCTCCGCACATGGGTGGAAACCACTCACCAGGGGGTCCACACCATCTTCCTCCC
CCCGAGGTAGCTCGTATGATTCCATGTCGATACTACCCCGCCTGTCGTTATGGTCCTTCGTGCATTTTTTTGCAT
CCCCCTCAAGGTTATTATCCCAACGGTGCTCCGCCCCCTGCACCTTACCCTCATTATGACCCCATGGGTGCTCCT
CCTTTCTCTCCCAACTTTTACCCGCCGCCCACCTACCAGCAGGCTAATGGTCCGCTTCCCATGACGCCTCTTTCC
CCACCACCTGGCCCTCCCCATATCGTACACGCTAGGTCAACATCAGAAATTGTCTCGCCTACCCAAGGGCACTTT
AGTCCGAATGGGGTTTCGCCTCCCGTACCGTATGGACCCATGTCACCTTCATACCCTCATTCTGCGCCAATGCCA
GTCCCACTTTCGGGTCCCCCCGTACCCCCACTCCACCATCAACCACAGCCTCAACTTCCCCCTCCCGGGCCCCAG
TCACCTACGAATTTTTCGCCTTCGCCCGTAGGTCCCTTCAATGTTCAACCGGATGGTCCCGCCATGTATCCTCAA
CAGCAACCATCATTGTCCAATGGGAACGTAAGCTTTGCGCCGGAGGTTGATGGCATGCCCAAGCCTCAACCTGGG
GCCGAAGGTTTTGTTAACGGTGTTCCTCATCCTCATACTCGCGATGTACCCATGCATGCTCGTCGGAGTAGTCGA
CGCGCTTCCTTCGGGAAGCCTAAACCTCCTTGTCTTTTCTTCCCCACCGGGAGGTGTAAAAATGGGTACGTGATT
CCCCGATATAGAACAGTTTATTTTTTTGCCAATATGCCTTCCAAAAATGCATTTTTTACTGATTGCTGAATTTAC
TACACAGTGACGACTGTCGGTTCCCCCATATCATGCCCGACGGCACTAGTGCATCTACAAATCATCATGCACCTT
TCTATGCAGGGAGGGGAGGTGGTCCCAGACAGCCACGTGGTCAGTTCCTACATAATGGCTTGGAAGAAAAGTTCA
ATAATATGAACATTCGAGATGTGAGGGACCAGCCGTAGCGCTTTTCTTTTCTTTTACGTACCATGTGTGTTGATT
GTATGATTCAATTCAGGAATCCCAGATCCAACAAAATGGCGTCGATGTTGCGTCAAAATCTTTGAACACCGCCAA
TGACAATGGACCAGTTGTCAATACTCGTCCTCGATTTCCGCCTAGTGGTAAACACCATCAACACCACCCTCATCA
CGGCTTCAACCCACAGCACAACCATTATAACGGAAAGTTGCAAAAATTGAATGTGCAAGGGAACATGAAGCAACG
TGTGCCGAATGCTGACGATTTCCCTGTTCTCGCTGGAACCATCACACCGCCTTCGAAGAGCCCCTTGACAGTAAA
TGGACCGACTGCTGCTCAAATCCTACAAGCACCGGCACCTATGAGGAAAGAGGTCTCGTCGCTTATCAATGGAAA
AGAAGCTAGCACGCGTGGGACAACTCCTGAACGATCTCGGTCGCCTAGCATAAAGGTAAAATCGCCTCAGTTGAA
AGGTGTAACAAGCTGCTGAACCTCCGCTTGTGAACAGGATTCCCCGCAATATCAGGACAACGGAGTTCCTGATGA
TAATGTTTCTTCTGAGCCCCCCGCCAATAAACTTCCTGTCTCATTCGCGGCTGCAGCTACTGCAGCCAAGGGATC
TGCAGCACCAGATATTGCAAAAGAGGTGTCTGTCTCTGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail