Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|003060
Gene name
Locationscaffold_1:780188..782052
Strand-
Gene length (bp)1864
Transcript length (bp)1218
Coding sequence length (bp)1218
Protein length (aa) 406

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00491 Arginase Arginase family 6.3E-88 88 389

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10088|SPEB1_SCHPO Putative agmatinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.09 PE=3 SV=1 60 394 7.0E-119
sp|O42887|SPEB2_SCHPO Putative agmatinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.03 PE=3 SV=1 4 391 4.0E-118
sp|Q9C0Y9|SPEB3_SCHPO Putative agmatinase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.03 PE=3 SV=2 65 394 8.0E-112
sp|Q6CIB4|GBU1_KLULA Guanidinobutyrase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GBU1 PE=1 SV=1 31 398 1.0E-106
sp|Q8KZT5|GBH_ARTS8 Guanidinobutyrase OS=Arthrobacter sp. (strain KUJ 8602) GN=gbh PE=1 SV=1 65 396 1.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10088|SPEB1_SCHPO Putative agmatinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.09 PE=3 SV=1 60 394 7.0E-119
sp|O42887|SPEB2_SCHPO Putative agmatinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.03 PE=3 SV=1 4 391 4.0E-118
sp|Q9C0Y9|SPEB3_SCHPO Putative agmatinase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.03 PE=3 SV=2 65 394 8.0E-112
sp|Q6CIB4|GBU1_KLULA Guanidinobutyrase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GBU1 PE=1 SV=1 31 398 1.0E-106
sp|Q8KZT5|GBH_ARTS8 Guanidinobutyrase OS=Arthrobacter sp. (strain KUJ 8602) GN=gbh PE=1 SV=1 65 396 1.0E-74
sp|Q7P0S6|SPEB_CHRVO Agmatinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=speB PE=3 SV=1 57 393 1.0E-56
sp|Q9I3S3|GBUA_PSEAE Guanidinobutyrase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gbuA PE=1 SV=1 65 393 2.0E-54
sp|Q7N122|SPEB_PHOLL Agmatinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=speB PE=3 SV=1 91 392 9.0E-54
sp|A1KVF9|SPEB_NEIMF Agmatinase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=speB PE=3 SV=1 88 392 9.0E-54
sp|A9M254|SPEB_NEIM0 Agmatinase OS=Neisseria meningitidis serogroup C (strain 053442) GN=speB PE=3 SV=1 88 392 9.0E-54
sp|P60654|SPEB_NEIMB Agmatinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=speB PE=3 SV=1 88 392 3.0E-53
sp|P60653|SPEB_NEIMA Agmatinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=speB PE=3 SV=1 88 392 3.0E-53
sp|B4RP98|SPEB_NEIG2 Agmatinase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=speB PE=3 SV=1 88 392 9.0E-53
sp|Q5F6R3|SPEB_NEIG1 Agmatinase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=speB PE=3 SV=1 88 392 9.0E-53
sp|Q7X3P1|SPEB_PROMI Agmatinase OS=Proteus mirabilis GN=speB PE=3 SV=2 88 392 5.0E-52
sp|B4F1A3|SPEB_PROMH Agmatinase OS=Proteus mirabilis (strain HI4320) GN=speB PE=3 SV=1 88 392 5.0E-52
sp|A8GIX7|SPEB_SERP5 Agmatinase OS=Serratia proteamaculans (strain 568) GN=speB PE=3 SV=1 68 383 3.0E-51
sp|Q1R791|SPEB_ECOUT Agmatinase OS=Escherichia coli (strain UTI89 / UPEC) GN=speB PE=3 SV=1 54 376 3.0E-50
sp|Q8FE36|SPEB_ECOL6 Agmatinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=speB PE=3 SV=1 54 376 3.0E-50
sp|Q0TDR4|SPEB_ECOL5 Agmatinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=speB PE=3 SV=1 54 376 3.0E-50
sp|A1AFC5|SPEB_ECOK1 Agmatinase OS=Escherichia coli O1:K1 / APEC GN=speB PE=3 SV=1 54 376 3.0E-50
sp|B7MZN5|SPEB_ECO81 Agmatinase OS=Escherichia coli O81 (strain ED1a) GN=speB PE=3 SV=1 54 376 3.0E-50
sp|B7MMC5|SPEB_ECO45 Agmatinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=speB PE=3 SV=1 54 376 3.0E-50
sp|B7UHY3|SPEB_ECO27 Agmatinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=speB PE=3 SV=1 54 376 3.0E-50
sp|A6TDU9|SPEB_KLEP7 Agmatinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=speB PE=3 SV=1 54 376 4.0E-50
sp|B5XUB2|SPEB_KLEP3 Agmatinase OS=Klebsiella pneumoniae (strain 342) GN=speB PE=3 SV=1 54 376 4.0E-50
sp|B2U0V8|SPEB_SHIB3 Agmatinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=speB PE=3 SV=1 54 376 4.0E-50
sp|A4WE75|SPEB_ENT38 Agmatinase OS=Enterobacter sp. (strain 638) GN=speB PE=3 SV=1 54 376 5.0E-50
sp|P60657|SPEB_SHIFL Agmatinase OS=Shigella flexneri GN=speB PE=3 SV=1 54 376 5.0E-50
sp|Q0T0V7|SPEB_SHIF8 Agmatinase OS=Shigella flexneri serotype 5b (strain 8401) GN=speB PE=3 SV=1 54 376 5.0E-50
sp|Q31WK0|SPEB_SHIBS Agmatinase OS=Shigella boydii serotype 4 (strain Sb227) GN=speB PE=3 SV=1 54 376 5.0E-50
sp|B7LPE7|SPEB_ESCF3 Agmatinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=speB PE=3 SV=1 54 376 5.0E-50
sp|B1LDE6|SPEB_ECOSM Agmatinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=speB PE=3 SV=1 54 376 5.0E-50
sp|B7N7I9|SPEB_ECOLU Agmatinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=speB PE=3 SV=1 54 376 5.0E-50
sp|P60651|SPEB_ECOLI Agmatinase OS=Escherichia coli (strain K12) GN=speB PE=1 SV=1 54 376 5.0E-50
sp|B1IT67|SPEB_ECOLC Agmatinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=speB PE=3 SV=1 54 376 5.0E-50
sp|B1XF99|SPEB_ECODH Agmatinase OS=Escherichia coli (strain K12 / DH10B) GN=speB PE=3 SV=1 54 376 5.0E-50
sp|C5A0K6|SPEB_ECOBW Agmatinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=speB PE=3 SV=1 54 376 5.0E-50
sp|B7LYW6|SPEB_ECO8A Agmatinase OS=Escherichia coli O8 (strain IAI1) GN=speB PE=3 SV=1 54 376 5.0E-50
sp|B5YQD4|SPEB_ECO5E Agmatinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=speB PE=3 SV=1 54 376 5.0E-50
sp|P60652|SPEB_ECO57 Agmatinase OS=Escherichia coli O157:H7 GN=speB PE=3 SV=1 54 376 5.0E-50
sp|A7ZR59|SPEB_ECO24 Agmatinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=speB PE=3 SV=1 54 376 5.0E-50
sp|Q32C02|SPEB_SHIDS Agmatinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=speB PE=3 SV=1 54 376 6.0E-50
sp|B6I775|SPEB_ECOSE Agmatinase OS=Escherichia coli (strain SE11) GN=speB PE=3 SV=1 54 376 6.0E-50
sp|B7LFJ6|SPEB_ECO55 Agmatinase OS=Escherichia coli (strain 55989 / EAEC) GN=speB PE=3 SV=1 54 376 6.0E-50
sp|B7NI01|SPEB_ECO7I Agmatinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=speB PE=3 SV=1 54 376 8.0E-50
sp|Q3YXT4|SPEB_SHISS Agmatinase OS=Shigella sonnei (strain Ss046) GN=speB PE=3 SV=1 54 376 1.0E-49
sp|Q2NRD3|SPEB_SODGM Agmatinase OS=Sodalis glossinidius (strain morsitans) GN=speB PE=3 SV=1 88 390 1.0E-49
sp|A7MJQ1|SPEB_CROS8 Agmatinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=speB PE=3 SV=1 54 376 2.0E-49
sp|A8APF8|SPEB_CITK8 Agmatinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=speB PE=3 SV=1 54 376 4.0E-49
sp|A8A477|SPEB_ECOHS Agmatinase OS=Escherichia coli O9:H4 (strain HS) GN=speB PE=3 SV=1 54 376 4.0E-49
sp|P60656|SPEB_SALTY Agmatinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=speB PE=3 SV=1 54 376 1.0E-48
sp|P60655|SPEB_SALTI Agmatinase OS=Salmonella typhi GN=speB PE=3 SV=1 54 376 1.0E-48
sp|B4TV53|SPEB_SALSV Agmatinase OS=Salmonella schwarzengrund (strain CVM19633) GN=speB PE=3 SV=1 54 376 1.0E-48
sp|B5BFP3|SPEB_SALPK Agmatinase OS=Salmonella paratyphi A (strain AKU_12601) GN=speB PE=3 SV=1 54 376 1.0E-48
sp|C0PY54|SPEB_SALPC Agmatinase OS=Salmonella paratyphi C (strain RKS4594) GN=speB PE=3 SV=1 54 376 1.0E-48
sp|A9N3R6|SPEB_SALPB Agmatinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=speB PE=3 SV=1 54 376 1.0E-48
sp|Q5PJH7|SPEB_SALPA Agmatinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=speB PE=3 SV=1 54 376 1.0E-48
sp|B4T5I5|SPEB_SALNS Agmatinase OS=Salmonella newport (strain SL254) GN=speB PE=3 SV=1 54 376 1.0E-48
sp|B4THG3|SPEB_SALHS Agmatinase OS=Salmonella heidelberg (strain SL476) GN=speB PE=3 SV=1 54 376 1.0E-48
sp|Q57K36|SPEB_SALCH Agmatinase OS=Salmonella choleraesuis (strain SC-B67) GN=speB PE=3 SV=1 54 376 1.0E-48
sp|B5F5K3|SPEB_SALA4 Agmatinase OS=Salmonella agona (strain SL483) GN=speB PE=3 SV=1 54 376 1.0E-48
sp|B5RE39|SPEB_SALG2 Agmatinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=speB PE=3 SV=1 54 376 1.0E-48
sp|B5QXK5|SPEB_SALEP Agmatinase OS=Salmonella enteritidis PT4 (strain P125109) GN=speB PE=3 SV=1 54 376 1.0E-48
sp|B5FUJ0|SPEB_SALDC Agmatinase OS=Salmonella dublin (strain CT_02021853) GN=speB PE=3 SV=1 54 376 1.0E-48
sp|P0DJQ3|PAH_STRCL Proclavaminate amidinohydrolase OS=Streptomyces clavuligerus GN=pah PE=1 SV=1 87 393 5.0E-48
sp|P0DJQ4|PAH_STRC2 Proclavaminate amidinohydrolase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=pah PE=3 SV=1 87 393 5.0E-48
sp|C5BAV1|SPEB_EDWI9 Agmatinase OS=Edwardsiella ictaluri (strain 93-146) GN=speB PE=3 SV=1 88 376 5.0E-48
sp|Q90XD2|SPEB_CHICK Agmatinase, mitochondrial OS=Gallus gallus GN=AGMAT PE=2 SV=1 67 393 5.0E-48
sp|Q9BSE5|SPEB_HUMAN Agmatinase, mitochondrial OS=Homo sapiens GN=AGMAT PE=1 SV=2 87 393 2.0E-46
sp|Q9I6K2|GPUA_PSEAE Guanidinopropionase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gpuA PE=1 SV=1 65 393 8.0E-46
sp|Q7VRG4|SPEB_BLOFL Agmatinase OS=Blochmannia floridanus GN=speB PE=3 SV=1 88 383 3.0E-44
sp|Q0D2L3|SPEB_RAT Agmatinase, mitochondrial OS=Rattus norvegicus GN=Agmat PE=2 SV=1 70 393 2.0E-43
sp|A2AS89|SPEB_MOUSE Agmatinase, mitochondrial OS=Mus musculus GN=Agmat PE=1 SV=1 67 393 6.0E-42
sp|Q81JT1|SPEB_BACAN Agmatinase OS=Bacillus anthracis GN=speB PE=3 SV=1 60 390 4.0E-39
sp|Q814Q2|SPEB_BACCR Agmatinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=speB PE=3 SV=1 60 390 5.0E-39
sp|P70999|SPEB_BACSU Agmatinase OS=Bacillus subtilis (strain 168) GN=speB PE=1 SV=1 60 394 7.0E-36
sp|Q9K6B9|SPEB_BACHD Agmatinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=speB PE=3 SV=2 91 390 8.0E-34
sp|Q57757|Y309_METJA Uncharacterized protein MJ0309 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0309 PE=3 SV=1 71 394 1.0E-30
sp|P73270|SPEB2_SYNY3 Probable agmatinase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=speB2 PE=3 SV=1 65 396 1.0E-27
sp|P19268|YHMF_METFE Uncharacterized 32.2 kDa protein in hmfB 3'region OS=Methanothermus fervidus PE=3 SV=1 90 390 4.0E-21
sp|Q72JK8|SPEBH_THET2 N(1)-aminopropylagmatine ureohydrolase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C0764 PE=1 SV=1 89 379 2.0E-20
sp|Q5SJ85|SEPBH_THET8 N(1)-aminopropylagmatine ureohydrolase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA1129 PE=1 SV=1 89 379 8.0E-20
sp|Q9ZPF5|ARGI2_ARATH Arginase 2, mitochondrial OS=Arabidopsis thaliana GN=ARGAH2 PE=2 SV=1 90 389 3.0E-18
sp|Q5JI38|SPEBH_THEKO N(1)-aminopropylagmatine ureohydrolase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0882 PE=1 SV=1 91 386 1.0E-17
sp|P46637|ARGI1_ARATH Arginase 1, mitochondrial OS=Arabidopsis thaliana GN=ARGAH1 PE=2 SV=1 90 389 1.0E-17
sp|B8AU84|ARGI1_ORYSI Arginase 1, mitochondrial OS=Oryza sativa subsp. indica GN=B0616E02-H0507E05.7 PE=1 SV=1 90 389 3.0E-17
sp|Q7X7N2|ARGI1_ORYSJ Arginase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=ARG1 PE=2 SV=1 90 389 3.0E-17
sp|O49046|ARGI_SOYBN Arginase OS=Glycine max GN=AG1 PE=2 SV=1 91 389 5.0E-17
sp|P39138|ARGI_BACSU Arginase OS=Bacillus subtilis (strain 168) GN=rocF PE=1 SV=1 89 394 3.0E-15
sp|Q9KBE3|HUTG_BACHD Formimidoylglutamase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hutG PE=3 SV=1 89 391 1.0E-12
sp|Q6GER3|ARGI_STAAR Arginase OS=Staphylococcus aureus (strain MRSA252) GN=arg PE=3 SV=1 89 394 1.0E-12
sp|Q12611|ARGI_EMENI Arginase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agaA PE=3 SV=2 199 392 2.0E-12
sp|P42068|HUTG_BACSU Formimidoylglutamase OS=Bacillus subtilis (strain 168) GN=hutG PE=1 SV=1 90 395 3.0E-12
sp|P72703|SPEB1_SYNY3 Agmatinase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=speB1 PE=3 SV=1 89 370 1.0E-11
sp|Q8FQ76|HUTG_COREF Formimidoylglutamase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=hutG PE=3 SV=1 179 394 2.0E-11
sp|P53608|ARGI_BACCD Arginase OS=Bacillus caldovelox GN=rocF PE=1 SV=1 89 382 7.0E-11
sp|P37818|ARGI1_SCHPO Arginase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=car1 PE=3 SV=1 199 394 2.0E-10
sp|Q10066|ARGI2_SCHPO Arginase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aru1 PE=3 SV=1 198 394 2.0E-10
sp|Q8NVE3|ARGI_STAAW Arginase OS=Staphylococcus aureus (strain MW2) GN=arg PE=3 SV=1 89 390 2.0E-10
sp|Q6G7E9|ARGI_STAAS Arginase OS=Staphylococcus aureus (strain MSSA476) GN=arg PE=3 SV=1 89 390 2.0E-10
sp|O08701|ARGI2_RAT Arginase-2, mitochondrial OS=Rattus norvegicus GN=Arg2 PE=2 SV=1 89 391 3.0E-10
sp|P33280|ARGI_NEUCR Arginase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aga-1 PE=1 SV=3 198 370 3.0E-10
sp|P60088|ARGI_STAAN Arginase OS=Staphylococcus aureus (strain N315) GN=arg PE=1 SV=1 201 390 4.0E-10
sp|P60087|ARGI_STAAM Arginase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arg PE=3 SV=1 201 390 4.0E-10
sp|P60086|ARGI_STAAC Arginase OS=Staphylococcus aureus (strain COL) GN=arg PE=3 SV=1 201 390 4.0E-10
sp|P78540|ARGI2_HUMAN Arginase-2, mitochondrial OS=Homo sapiens GN=ARG2 PE=1 SV=1 77 386 4.0E-10
sp|Q91554|ARGN2_XENLA Arginase, non-hepatic 2 OS=Xenopus laevis GN=arg2-b PE=2 SV=1 89 391 5.0E-10
sp|Q1E180|ARGI_COCIM Arginase OS=Coccidioides immitis (strain RS) GN=ARG PE=3 SV=1 188 373 6.0E-10
sp|P40906|ARGI_COCP7 Arginase OS=Coccidioides posadasii (strain C735) GN=ARG PE=3 SV=2 188 373 6.0E-10
sp|Q7M0Z3|ARGI_BREBE Arginase OS=Brevibacillus brevis GN=rocF PE=1 SV=1 88 382 7.0E-10
sp|P0A2Y0|ARGI_BRUSU Arginase OS=Brucella suis biovar 1 (strain 1330) GN=arcB PE=3 SV=1 199 398 8.0E-10
sp|P0A2X9|ARGI_BRUME Arginase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=arcB PE=3 SV=1 199 398 8.0E-10
sp|P0A2Y1|ARGI_BRUAB Arginase OS=Brucella abortus biovar 1 (strain 9-941) GN=arcB PE=3 SV=1 199 398 8.0E-10
sp|Q91553|ARGN1_XENLA Arginase, non-hepatic 1 OS=Xenopus laevis GN=arg2-a PE=2 SV=1 89 391 8.0E-10
sp|O08691|ARGI2_MOUSE Arginase-2, mitochondrial OS=Mus musculus GN=Arg2 PE=1 SV=1 89 391 8.0E-10
sp|Q58DL1|ARGI2_BOVIN Arginase-2, mitochondrial OS=Bos taurus GN=ARG2 PE=2 SV=1 82 391 3.0E-09
sp|Q91555|ARGN3_XENLA Arginase, non-hepatic 3 OS=Xenopus laevis GN=arg2-c PE=2 SV=1 89 391 4.0E-09
sp|Q6CLS8|ARGI_KLULA Arginase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CAR1 PE=1 SV=1 199 370 2.0E-08
sp|P49900|ARGI_LITCT Arginase, hepatic OS=Lithobates catesbeiana PE=2 SV=1 198 395 3.0E-08
sp|P05089|ARGI1_HUMAN Arginase-1 OS=Homo sapiens GN=ARG1 PE=1 SV=2 89 371 8.0E-08
sp|Q74ZW4|ARGI_ASHGO Arginase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CAR1 PE=3 SV=1 199 370 1.0E-07
sp|A8Z523|HUTG_STAAT Formimidoylglutamase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=hutG PE=3 SV=1 80 391 2.0E-07
sp|P99158|HUTG_STAAN Formimidoylglutamase OS=Staphylococcus aureus (strain N315) GN=hutG PE=1 SV=1 80 391 2.0E-07
sp|P63570|HUTG_STAAM Formimidoylglutamase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=hutG PE=3 SV=1 80 391 2.0E-07
sp|A6QJH5|HUTG_STAAE Formimidoylglutamase OS=Staphylococcus aureus (strain Newman) GN=hutG PE=3 SV=1 80 391 2.0E-07
sp|Q5HDM3|HUTG_STAAC Formimidoylglutamase OS=Staphylococcus aureus (strain COL) GN=hutG PE=3 SV=1 80 391 2.0E-07
sp|A5IVB6|HUTG_STAA9 Formimidoylglutamase OS=Staphylococcus aureus (strain JH9) GN=hutG PE=3 SV=1 80 391 2.0E-07
sp|Q2FVT2|HUTG_STAA8 Formimidoylglutamase OS=Staphylococcus aureus (strain NCTC 8325) GN=hutG PE=3 SV=1 80 391 2.0E-07
sp|Q2FEG2|HUTG_STAA3 Formimidoylglutamase OS=Staphylococcus aureus (strain USA300) GN=hutG PE=3 SV=1 80 391 2.0E-07
sp|A6U459|HUTG_STAA2 Formimidoylglutamase OS=Staphylococcus aureus (strain JH1) GN=hutG PE=3 SV=1 80 391 2.0E-07
sp|A7X5U0|HUTG_STAA1 Formimidoylglutamase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=hutG PE=3 SV=1 80 391 2.0E-07
sp|B9DLS6|HUTG_STACT Formimidoylglutamase OS=Staphylococcus carnosus (strain TM300) GN=hutG PE=3 SV=1 194 390 3.0E-07
sp|Q6GEA1|HUTG_STAAR Formimidoylglutamase OS=Staphylococcus aureus (strain MRSA252) GN=hutG PE=3 SV=1 80 391 3.0E-07
sp|P00812|ARGI_YEAST Arginase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAR1 PE=1 SV=1 199 370 3.0E-07
sp|Q2YYV4|HUTG_STAAB Formimidoylglutamase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=hutG PE=3 SV=1 80 391 7.0E-07
sp|Q8CNA3|HUTG_STAES Formimidoylglutamase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=hutG PE=3 SV=1 89 390 1.0E-06
sp|Q5HLR4|HUTG_STAEQ Formimidoylglutamase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=hutG PE=3 SV=1 89 390 1.0E-06
sp|Q95KM0|ARGI1_RABIT Arginase-1 OS=Oryctolagus cuniculus GN=ARG1 PE=2 SV=2 89 371 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|003060
MVLKIISFTALLLSIPVPLVTGQHHEPQVVLGQNSIVDGPIFPDAEAIKEPTWLEKYGPQIDQPFSGPLSFSHLP
YHRCLEKEDVLFDIAIIGMPLDTTVSYRTGARFGPYAIRSGSRRQREVRGYTMSWGVNPYEQGSKVIDCGDVPVS
PYDNALAVDQIEVAYSSLLARTPASVKEGSASPGHPVLSKDGLTHPRVVSLGGDHTIVLPILRSLYKVYGPISVI
HFDAHLDTWASYPGQATEQSRVTHGTFFYLASEEGLIANNSIHAGIRCKLGGPSDLENDNVVGFQVITTDDIDDY
HIPAIVKRIRERIGDSPVYLSLDIDVVDPGLAPGTGTPEAGGWTVREVKRILRGLAGLNFVGADVVEVAPAYDHA
ETTAIAAADFVHDFLSMFLTNNPPKARSVL*
Coding >AgabiH97|003060
ATGGTTTTGAAGATAATCAGTTTCACCGCTCTTTTGCTCTCGATACCCGTGCCATTGGTGACGGGGCAACACCAC
GAACCTCAGGTGGTTTTGGGACAAAACTCTATTGTCGATGGTCCTATTTTCCCTGATGCAGAGGCGATCAAAGAA
CCGACTTGGCTAGAAAAGTACGGTCCGCAGATTGATCAACCTTTTTCCGGACCTCTCTCCTTCTCGCATCTGCCA
TATCATCGCTGTTTGGAGAAAGAAGATGTATTATTCGATATCGCGATTATTGGAATGCCTCTTGACACCACGGTT
AGTTACCGAACGGGTGCACGATTTGGCCCGTATGCGATTCGTTCTGGAAGTAGAAGGCAGAGGGAAGTGAGGGGA
TATACTATGTCGTGGGGTGTAAATCCTTATGAGCAAGGTTCAAAGGTTATTGATTGTGGAGACGTGCCTGTTAGT
CCCTATGACAATGCGTTGGCTGTAGATCAGATAGAGGTTGCTTATTCATCTCTGCTCGCGAGAACGCCTGCATCC
GTCAAGGAGGGTTCTGCAAGCCCTGGACATCCTGTTCTGTCTAAAGATGGATTAACTCATCCACGAGTCGTAAGC
CTTGGCGGAGATCATACAATTGTTCTACCCATCCTTCGGTCCTTGTACAAAGTCTACGGTCCCATATCCGTTATT
CACTTCGACGCGCATCTGGATACTTGGGCATCATACCCAGGCCAAGCGACTGAGCAGTCCCGCGTCACTCACGGC
ACCTTCTTTTATCTCGCCAGCGAAGAAGGTCTCATCGCTAATAACAGCATCCATGCTGGAATCCGCTGCAAACTC
GGCGGTCCATCGGATTTAGAAAATGACAACGTTGTTGGCTTTCAGGTAATAACGACGGATGATATTGATGATTAC
CATATCCCTGCAATTGTCAAACGTATTCGAGAGCGTATTGGTGACAGCCCAGTATATCTCAGTCTCGACATCGAC
GTCGTCGACCCGGGATTGGCACCAGGAACTGGCACTCCTGAAGCGGGAGGATGGACCGTCCGTGAAGTCAAACGT
ATCCTCCGAGGACTCGCCGGTTTGAACTTTGTTGGTGCTGATGTTGTGGAAGTCGCACCTGCATATGATCATGCC
GAGACTACTGCGATAGCGGCTGCGGACTTTGTTCATGACTTTCTCTCTATGTTTTTGACCAATAATCCTCCCAAA
GCGAGAAGCGTATTATGA
Transcript >AgabiH97|003060
ATGGTTTTGAAGATAATCAGTTTCACCGCTCTTTTGCTCTCGATACCCGTGCCATTGGTGACGGGGCAACACCAC
GAACCTCAGGTGGTTTTGGGACAAAACTCTATTGTCGATGGTCCTATTTTCCCTGATGCAGAGGCGATCAAAGAA
CCGACTTGGCTAGAAAAGTACGGTCCGCAGATTGATCAACCTTTTTCCGGACCTCTCTCCTTCTCGCATCTGCCA
TATCATCGCTGTTTGGAGAAAGAAGATGTATTATTCGATATCGCGATTATTGGAATGCCTCTTGACACCACGGTT
AGTTACCGAACGGGTGCACGATTTGGCCCGTATGCGATTCGTTCTGGAAGTAGAAGGCAGAGGGAAGTGAGGGGA
TATACTATGTCGTGGGGTGTAAATCCTTATGAGCAAGGTTCAAAGGTTATTGATTGTGGAGACGTGCCTGTTAGT
CCCTATGACAATGCGTTGGCTGTAGATCAGATAGAGGTTGCTTATTCATCTCTGCTCGCGAGAACGCCTGCATCC
GTCAAGGAGGGTTCTGCAAGCCCTGGACATCCTGTTCTGTCTAAAGATGGATTAACTCATCCACGAGTCGTAAGC
CTTGGCGGAGATCATACAATTGTTCTACCCATCCTTCGGTCCTTGTACAAAGTCTACGGTCCCATATCCGTTATT
CACTTCGACGCGCATCTGGATACTTGGGCATCATACCCAGGCCAAGCGACTGAGCAGTCCCGCGTCACTCACGGC
ACCTTCTTTTATCTCGCCAGCGAAGAAGGTCTCATCGCTAATAACAGCATCCATGCTGGAATCCGCTGCAAACTC
GGCGGTCCATCGGATTTAGAAAATGACAACGTTGTTGGCTTTCAGGTAATAACGACGGATGATATTGATGATTAC
CATATCCCTGCAATTGTCAAACGTATTCGAGAGCGTATTGGTGACAGCCCAGTATATCTCAGTCTCGACATCGAC
GTCGTCGACCCGGGATTGGCACCAGGAACTGGCACTCCTGAAGCGGGAGGATGGACCGTCCGTGAAGTCAAACGT
ATCCTCCGAGGACTCGCCGGTTTGAACTTTGTTGGTGCTGATGTTGTGGAAGTCGCACCTGCATATGATCATGCC
GAGACTACTGCGATAGCGGCTGCGGACTTTGTTCATGACTTTCTCTCTATGTTTTTGACCAATAATCCTCCCAAA
GCGAGAAGCGTATTATGA
Gene >AgabiH97|003060
ATGGTTTTGAAGATAATCAGTTTCACCGCTCTTTTGCTCTCGATACCCGTGCCATTGGTGACGGGGCAACACCAC
GAACCTCAGGTGGTTTTGGGACAAAACTCTATTGTCGATGGTCCTATTTTCCCTGATGCAGAGGCGATCAAAGAA
CCGACTTGGCTAGAAAAGTACGGTCCGCAGATTGATCAACCTTTTTCCGGACCTCTCTCCTTCTCGCATCTGCCA
TATCATCGCTGTTTGGAGAAAGAAGATGTATTATTCGATATCGCGATTATTGGAATGCCTCTTGACACCACGGTT
AGTTACCGAACGGGGTGAGCATACGGTTTGATGTTGAAACATTGGTACACGACTGAGTATAGTTGATTACGTCAA
AAGTGCACGATTTGGCCCGTATGCGATTCGTTCTGGAAGTAGAAGGCAGAGGGAAGTGAGGGGATATACTATGTC
GTGGGGTGTAAATCCTTATGAGCAAGGTTCAAAGGTTATTGATTGTGGAGACGTGCGTTCAACTTTTTTCCTGTT
CCTTCTCATCTTTGGATTCAAATCGTTTGACATTACTAGGTGCCTGTTAGTCCCTATGACAATGCGTTGGCTGTA
GATCAGATAGAGGTTGCTTATTCATCTCTGCTCGCGAGAACGCCTGCATCCGTCAAGGAGGGTTCTGCAAGCCCT
GGACATCCTGTTCTGTCTAAAGATGGATTAACTCATCCACGAGTCGTAAGGTACGCTTGGGACCTTTAAGCTTTA
CCTTCGAAGATCATAATAAGTGAAATGTCTATTTAGCCTTGGCGGAGATCATACAATTGCGAGTATCTGAACTTG
AATTTTCTCTTCTCCGTGCTCAGGCTCGGGCACTCTAGGTTCTACCCATCCTTCGGTCCTTGTACAAAGTCTACG
GTCCCATATCCGTTATTCACTTCGACGCGCATCTGGTACGAGATGTTTTAACAACCTGTGTAGCGACTTTATCGA
ATGTCTTCTCTCTTACAGGATACTTGGGCATCATACCCAGGCCAAGCGACTGAGCAGTCCCGCGTCACTCACGGC
ACCTTCTTTTATCTCGCCAGCGAAGAAGGTCTCATCGCTAATAACAGCATCCATGCTGGAATCCGCTGCAAACTC
GGCGTACGTTTTGGACTTATTCAATCATTATAACCACTCAACCTTGAGTTAAAAAGGGTCCATCGGATTTAGAAA
ATGACAACGTTGTTGGCTTTCAGGTAATAACGACGGATGATATTGATGATTACCATATCCCTGCAATTGTCAAAC
GTATTCGAGAGCGTATTGGTGACAGCCCAGTATATCTCAGGTTTGTTCCCATCTCATCTCGGGTAGAAAGAATTC
TTACTCATGAGTATATCCACAGTCTCGACATCGACGTCGTCGGTATGTAAATACCCCCTATCAATGATACAACTT
CAACTGATCGTCAAATCATGAAGACCCGGGATTGGCACCAGGAAGTAAGTCCCTACATTCAGCTAACATGGTCCC
ATATCCCTAATCGTCATCTCGTATAGCTGGCACTCCTGAAGCGGGAGGATGGACCGTCCGTGAAGTCAAACGTAT
CCTCCGAGGACTCGCCGGTTTGAACTTTGTGTACGTCACATCACCTCTCTATTTACATCTTCGTGGATCTTCATG
CTATTTCCAGTGGTGCTGATGTTGTGGAAGTCGCACCTGCATATGATCATGGTGAGCAATCATGGAAAAAATATA
CTCCTTCTTTGGATCGGAGATTAATACTCAACTATGTGTTATAGCCGAGACTACTGCGATAGCGGCTGCGGACTT
TGTTCATGACTTTCTCTCTATGTTTTTGACCAATAATCCTCCCAAAGCGAGAAGCGTATTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail