Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|002910
Gene name
Locationscaffold_1:745491..746123
Strand-
Gene length (bp)632
Transcript length (bp)399
Coding sequence length (bp)399
Protein length (aa) 133

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00545 Ribonuclease ribonuclease 1.5E-07 51 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P81762|RNPO_PLEOS Guanyl-specific ribonuclease Po1 OS=Pleurotus ostreatus PE=1 SV=1 35 132 7.0E-40
sp|P00652|RNC2_ASPCL Guanyl-specific ribonuclease C2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_055300 PE=1 SV=2 30 130 1.0E-21
sp|Q7M515|RNA1_ASPPL Guanyl-specific ribonuclease Ap1 OS=Aspergillus pallidus PE=1 SV=1 39 130 2.0E-21
sp|P07736|RNU1_USTSP Guanyl-specific ribonuclease U1 OS=Ustilago sphaerogena PE=1 SV=2 36 132 2.0E-21
sp|P16412|RNF2_GIBBA Extracellular guanyl-specific ribonuclease Fl2 OS=Gibberella baccata PE=1 SV=2 36 131 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P81762|RNPO_PLEOS Guanyl-specific ribonuclease Po1 OS=Pleurotus ostreatus PE=1 SV=1 35 132 7.0E-40
sp|P00652|RNC2_ASPCL Guanyl-specific ribonuclease C2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_055300 PE=1 SV=2 30 130 1.0E-21
sp|Q7M515|RNA1_ASPPL Guanyl-specific ribonuclease Ap1 OS=Aspergillus pallidus PE=1 SV=1 39 130 2.0E-21
sp|P07736|RNU1_USTSP Guanyl-specific ribonuclease U1 OS=Ustilago sphaerogena PE=1 SV=2 36 132 2.0E-21
sp|P16412|RNF2_GIBBA Extracellular guanyl-specific ribonuclease Fl2 OS=Gibberella baccata PE=1 SV=2 36 131 1.0E-20
sp|P09646|RNN1_NEUCR Guanyl-specific ribonuclease N1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grn PE=1 SV=2 34 131 4.0E-19
sp|P10282|RNF1_GIBFU Guanyl-specific ribonuclease F1 OS=Gibberella fujikuroi PE=1 SV=4 25 130 7.0E-19
sp|P07446|RNPB_PENBR Guanyl-specific ribonuclease Pb1 OS=Penicillium brevicompactum PE=1 SV=1 63 130 5.0E-18
sp|P00651|RNT1_ASPOR Guanyl-specific ribonuclease T1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rntA PE=1 SV=2 60 130 8.0E-18
sp|P09647|RNPC_PENCH Guanyl-specific ribonuclease Pc OS=Penicillium chrysogenum PE=1 SV=1 63 131 2.0E-17
sp|P16411|RNF1_GIBBA Extracellular guanyl-specific ribonuclease Fl1 OS=Gibberella baccata PE=1 SV=1 35 130 5.0E-17
sp|D4AVI0|RNF1_ARTBC Extracellular guanyl-specific ribonuclease ARB_00194 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00194 PE=1 SV=1 36 131 8.0E-17
sp|P00653|RNMS_ASPPH Guanyl-specific ribonuclease Ms OS=Aspergillus phoenicis PE=1 SV=2 63 131 1.0E-16
sp|P26875|RNT1_TRIHA Guanyl-specific ribonuclease Th1 OS=Trichoderma harzianum PE=1 SV=1 51 130 7.0E-15
sp|P00654|RNU2_USTSP Ribonuclease U2 OS=Ustilago sphaerogena GN=RNU2 PE=1 SV=4 35 130 3.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0004521 endoribonuclease activity Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0004540 ribonuclease activity No
GO:0097159 organic cyclic compound binding No
GO:0004519 endonuclease activity No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0140098 catalytic activity, acting on RNA No
GO:0004518 nuclease activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|002910
MRSILSSAPVLLAVVSGFLFQAVKAIPFDLEARAQACNCAGRSYSATSVQNGINKALSGGAGDYPHEYHNFEGFN
FGCSGSTYFEYPILTSGTYNGGSPGADRVVYDNLDNFCSCLTHTGAPSTNGFVECNF*
Coding >AgabiH97|002910
ATGCGATCCATCCTGTCTTCCGCTCCAGTCCTCTTGGCCGTTGTTTCAGGCTTCCTCTTCCAAGCTGTTAAGGCC
ATCCCTTTCGATCTCGAAGCAAGGGCACAGGCTTGTAATTGTGCCGGACGCAGTTATTCTGCTACATCGGTCCAA
AATGGTATTAACAAGGCGCTGTCAGGGGGCGCTGGCGACTATCCCCATGAGTATCACAACTTTGAGGGTTTCAAC
TTTGGCTGCTCTGGCAGCACCTATTTCGAGTATCCCATCCTGACCAGCGGTACATATAACGGTGGATCCCCTGGC
GCCGACCGCGTTGTCTATGACAACCTCGATAACTTCTGTTCCTGCCTTACCCACACTGGCGCCCCGTCCACCAAT
GGTTTTGTGGAATGTAACTTCTAA
Transcript >AgabiH97|002910
ATGCGATCCATCCTGTCTTCCGCTCCAGTCCTCTTGGCCGTTGTTTCAGGCTTCCTCTTCCAAGCTGTTAAGGCC
ATCCCTTTCGATCTCGAAGCAAGGGCACAGGCTTGTAATTGTGCCGGACGCAGTTATTCTGCTACATCGGTCCAA
AATGGTATTAACAAGGCGCTGTCAGGGGGCGCTGGCGACTATCCCCATGAGTATCACAACTTTGAGGGTTTCAAC
TTTGGCTGCTCTGGCAGCACCTATTTCGAGTATCCCATCCTGACCAGCGGTACATATAACGGTGGATCCCCTGGC
GCCGACCGCGTTGTCTATGACAACCTCGATAACTTCTGTTCCTGCCTTACCCACACTGGCGCCCCGTCCACCAAT
GGTTTTGTGGAATGTAACTTCTAA
Gene >AgabiH97|002910
ATGCGATCCATCCTGTCTTCCGCTCCAGTCCTCTTGGCCGTTGTTTCAGGCTTCCTCTTCCAAGCTGTTAAGGCC
ATCCCTTTCGATCTCGAAGCAAGGGCACAGGCTTGTAATTGTGCCGGTCCGTGATTACCGTTTATATCATACGCT
GATCTATCGCACTGACCTCGTTGATAATCACAGGACGCAGTTATTCTGCTACATCGGTCCAAAATGGTATTAACA
AGGCGCTGTCAGGGGGCGCTGGGTGGGTTGGGACAATTGTTCTTTCAACTGATCAAGCTGACGTCCTCGCAACGA
TCCAGCGACTATCCCCATGAGTATCACAACTTTGAGGTGAGCCTTAAGCTGAATTGGAAAGATGTGATGCCGGAT
CTGACCTTGATAATGTGCTGCAGGGTTTCAACTTTGGCTGCTCTGGCAGCACCTATTTCGAGTATCCCATCCTGA
CCAGCGGTACATATAACGGTGGATCCCCTGGCGCCGACCGCGTTGTCTATGACAACCTCGATAACTTCTGTTGTA
TGTCAAAGATTTTTGATTTTGCACACAGTATCTTAGTTCTTTGCCTAGCCTGCCTTACCCACACTGGCGCCCCGT
CCACCAATGGTTTTGTGGAATGTAACTTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail