Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|002870
Gene name
Locationscaffold_1:730136..735044
Strand+
Gene length (bp)4908
Transcript length (bp)4437
Coding sequence length (bp)4437
Protein length (aa) 1479

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13415 Kelch_3 Galactose oxidase, central domain 9.0E-08 176 224
PF13415 Kelch_3 Galactose oxidase, central domain 3.1E-06 339 385
PF13418 Kelch_4 Galactose oxidase, central domain 6.0E-05 274 312
PF13418 Kelch_4 Galactose oxidase, central domain 4.0E-06 329 369
PF13418 Kelch_4 Galactose oxidase, central domain 2.8E-05 378 425
PF13854 Kelch_5 Kelch motif 5.2E-05 271 308
PF01344 Kelch_1 Kelch motif 1.4E-05 274 308
PF01344 Kelch_1 Kelch motif 3.0E-04 328 369
PF13964 Kelch_6 Kelch motif 1.2E-07 329 370

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 157 527 2.0E-69
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 87 496 5.0E-51
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 159 448 6.0E-45
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 169 546 2.0E-35
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 159 447 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 157 527 2.0E-69
sp|P38853|KEL1_YEAST Kelch repeat-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL1 PE=1 SV=1 87 496 5.0E-51
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 159 448 6.0E-45
sp|O14248|TEA3_SCHPO Tip elongation aberrant protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea3 PE=1 SV=1 169 546 2.0E-35
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 159 447 1.0E-23
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 133 435 2.0E-23
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 134 406 7.0E-22
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 134 406 9.0E-22
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 134 406 1.0E-21
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 134 406 1.0E-21
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 154 417 3.0E-21
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 161 387 4.0E-21
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 200 448 4.0E-21
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 133 435 1.0E-20
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 213 472 2.0E-20
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 261 435 2.0E-20
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 210 457 4.0E-20
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 210 457 4.0E-20
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 162 433 6.0E-20
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 210 457 6.0E-20
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 158 447 8.0E-20
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 158 447 9.0E-20
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 158 447 2.0E-19
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 212 447 2.0E-19
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 212 465 3.0E-19
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 212 465 3.0E-19
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 178 417 3.0E-19
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 178 417 4.0E-19
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 163 459 5.0E-19
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 161 387 1.0E-18
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 181 455 1.0E-18
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 178 417 1.0E-18
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 212 465 2.0E-18
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 160 447 3.0E-18
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 212 465 4.0E-18
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 161 387 5.0E-18
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 210 459 8.0E-18
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 257 477 1.0E-17
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 206 485 1.0E-17
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 210 459 1.0E-17
sp|P50090|KEL2_YEAST Kelch repeat-containing protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL2 PE=1 SV=1 261 449 2.0E-17
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 161 387 2.0E-17
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 198 447 2.0E-17
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 201 447 2.0E-17
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 212 449 2.0E-17
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 145 427 3.0E-17
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 161 387 4.0E-17
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 133 435 8.0E-17
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 324 447 1.0E-16
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 216 447 1.0E-16
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 257 471 1.0E-16
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 206 448 1.0E-16
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 104 427 1.0E-16
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 104 427 2.0E-16
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 104 427 2.0E-16
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 216 447 3.0E-16
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 201 447 3.0E-16
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 216 447 4.0E-16
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 213 466 4.0E-16
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 276 448 7.0E-16
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 259 435 9.0E-16
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 133 435 1.0E-15
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 261 447 1.0E-15
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 158 447 1.0E-15
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 183 447 1.0E-15
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 261 476 2.0E-15
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 213 447 2.0E-15
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 213 447 2.0E-15
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 257 447 3.0E-15
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 213 447 3.0E-15
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 145 447 3.0E-15
sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 263 485 5.0E-15
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 304 447 5.0E-15
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 151 447 5.0E-15
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 145 447 7.0E-15
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 155 425 8.0E-15
sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 263 485 9.0E-15
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 247 449 9.0E-15
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 304 447 1.0E-14
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 304 447 1.0E-14
sp|Q08979|KEL3_YEAST Kelch repeat-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL3 PE=1 SV=1 174 417 1.0E-14
sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 263 467 2.0E-14
sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 263 467 2.0E-14
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 261 447 2.0E-14
sp|Q921I2|KLDC4_MOUSE Kelch domain-containing protein 4 OS=Mus musculus GN=Klhdc4 PE=2 SV=2 156 425 2.0E-14
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 151 396 2.0E-14
sp|Q6GQN7|RABEK_DANRE Rab9 effector protein with kelch motifs OS=Danio rerio GN=rabepk PE=2 SV=1 163 406 3.0E-14
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 206 448 3.0E-14
sp|O04318|JAL27_ARATH Nitrile-specifier protein 3 OS=Arabidopsis thaliana GN=NSP3 PE=2 SV=1 260 460 3.0E-14
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 261 476 4.0E-14
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 145 447 5.0E-14
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 186 447 5.0E-14
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 145 447 6.0E-14
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 261 445 7.0E-14
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 261 447 8.0E-14
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 183 447 8.0E-14
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 160 447 1.0E-13
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 156 425 1.0E-13
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 159 447 1.0E-13
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 159 447 1.0E-13
sp|Q7Z6M1|RABEK_HUMAN Rab9 effector protein with kelch motifs OS=Homo sapiens GN=RABEPK PE=1 SV=1 206 468 2.0E-13
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 158 447 2.0E-13
sp|Q54C94|GEFF_DICDI Ras guanine nucleotide exchange factor F OS=Dictyostelium discoideum GN=gefF PE=2 SV=1 178 396 5.0E-13
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 213 446 5.0E-13
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 257 447 5.0E-13
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 213 466 6.0E-13
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 270 447 6.0E-13
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 213 349 7.0E-13
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 213 446 8.0E-13
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 210 448 8.0E-13
sp|O04316|JAL29_ARATH Nitrile-specifier protein 4 OS=Arabidopsis thaliana GN=NSP4 PE=2 SV=1 261 447 9.0E-13
sp|Q9C8K7|FBK21_ARATH F-box/kelch-repeat protein At1g51550 OS=Arabidopsis thaliana GN=At1g51550 PE=2 SV=1 213 469 9.0E-13
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 148 396 1.0E-12
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 158 447 1.0E-12
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 326 447 1.0E-12
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with kelch motifs OS=Bos taurus GN=RABEPK PE=2 SV=1 210 468 2.0E-12
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 228 425 3.0E-12
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 160 447 4.0E-12
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 228 425 4.0E-12
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 158 360 5.0E-12
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 158 360 6.0E-12
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 268 399 6.0E-12
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 158 360 8.0E-12
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 326 490 8.0E-12
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 261 478 1.0E-11
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 168 396 1.0E-11
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 160 447 1.0E-11
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 159 361 1.0E-11
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 159 447 4.0E-11
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 228 425 5.0E-11
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 160 396 6.0E-11
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 207 448 6.0E-11
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 267 447 8.0E-11
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 160 291 8.0E-11
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 268 457 8.0E-11
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 193 396 1.0E-10
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 267 447 1.0E-10
sp|Q9Y2U9|KLDC2_HUMAN Kelch domain-containing protein 2 OS=Homo sapiens GN=KLHDC2 PE=1 SV=1 314 498 1.0E-10
sp|Q80YG3|KLDC1_MOUSE Kelch domain-containing protein 1 OS=Mus musculus GN=Klhdc1 PE=2 SV=1 178 468 3.0E-10
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 168 400 3.0E-10
sp|Q19981|TAG53_CAEEL Putative protein tag-53 OS=Caenorhabditis elegans GN=tag-53 PE=1 SV=3 191 447 3.0E-10
sp|Q4G5Y1|KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus GN=Klhdc2 PE=2 SV=3 314 498 4.0E-10
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 159 413 4.0E-10
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 267 447 5.0E-10
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 267 447 6.0E-10
sp|Q3KRE6|KLDC2_RAT Kelch domain-containing protein 2 OS=Rattus norvegicus GN=Klhdc2 PE=2 SV=1 314 498 7.0E-10
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 160 435 9.0E-10
sp|Q5E9A7|KLDC2_BOVIN Kelch domain-containing protein 2 OS=Bos taurus GN=KLHDC2 PE=2 SV=1 314 498 9.0E-10
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 286 447 9.0E-10
sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=1 SV=2 160 413 1.0E-09
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 274 449 1.0E-09
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 286 447 1.0E-09
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 160 394 1.0E-09
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 261 471 2.0E-09
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 274 449 2.0E-09
sp|Q08979|KEL3_YEAST Kelch repeat-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL3 PE=1 SV=1 286 447 2.0E-09
sp|Q5RDA9|FBX42_PONAB F-box only protein 42 OS=Pongo abelii GN=FBXO42 PE=2 SV=1 160 394 2.0E-09
sp|Q9MA55|ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana GN=ACBP4 PE=1 SV=1 160 356 3.0E-09
sp|Q6P3S6|FBX42_HUMAN F-box only protein 42 OS=Homo sapiens GN=FBXO42 PE=1 SV=1 160 394 3.0E-09
sp|Q5ZJ37|RABEK_CHICK Rab9 effector protein with kelch motifs OS=Gallus gallus GN=RABEPK PE=2 SV=1 210 477 4.0E-09
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 145 348 4.0E-09
sp|Q8RWD9|ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana GN=ACBP5 PE=1 SV=1 160 355 6.0E-09
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 253 447 6.0E-09
sp|A6NCF5|KLH33_HUMAN Kelch-like protein 33 OS=Homo sapiens GN=KLHL33 PE=4 SV=2 269 469 9.0E-09
sp|Q8H4D4|TYW23_ORYSJ tRNA wybutosine-synthesizing protein 2/3/4 OS=Oryza sativa subsp. japonica GN=Os07g0515000 PE=2 SV=1 262 479 1.0E-08
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 163 468 1.0E-08
sp|Q08979|KEL3_YEAST Kelch repeat-containing protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEL3 PE=1 SV=1 192 370 1.0E-08
sp|Q6PDJ6|FBX42_MOUSE F-box only protein 42 OS=Mus musculus GN=Fbxo42 PE=1 SV=1 286 447 1.0E-08
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 253 447 1.0E-08
sp|Q5R8W1|KLDC4_PONAB Kelch domain-containing protein 4 OS=Pongo abelii GN=KLHDC4 PE=2 SV=1 306 465 2.0E-08
sp|Q8R2P1|KLH25_MOUSE Kelch-like protein 25 OS=Mus musculus GN=Klhl25 PE=2 SV=1 210 447 2.0E-08
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 253 465 2.0E-08
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 253 447 2.0E-08
sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 160 413 3.0E-08
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 158 397 3.0E-08
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 164 317 3.0E-08
sp|Q4KLM4|KLH25_RAT Kelch-like protein 25 OS=Rattus norvegicus GN=Klhl25 PE=2 SV=1 210 447 3.0E-08
sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=1 SV=2 160 413 4.0E-08
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 286 449 4.0E-08
sp|Q2R2W1|ADO3_ORYSJ Adagio-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0547000 PE=2 SV=2 206 447 4.0E-08
sp|Q9H0H3|KLH25_HUMAN Kelch-like protein 25 OS=Homo sapiens GN=KLHL25 PE=1 SV=1 210 447 4.0E-08
sp|Q8N7A1|KLDC1_HUMAN Kelch domain-containing protein 1 OS=Homo sapiens GN=KLHDC1 PE=2 SV=2 191 373 7.0E-08
sp|Q93XW5|NSP5_ARATH Nitrile-specifier protein 5 OS=Arabidopsis thaliana GN=NSP5 PE=2 SV=1 148 413 1.0E-07
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 326 456 1.0E-07
sp|Q9V4C8|HCF_DROME Host cell factor OS=Drosophila melanogaster GN=Hcf PE=1 SV=2 315 469 1.0E-07
sp|Q5U580|KLD10_XENLA Kelch domain-containing protein 10 OS=Xenopus laevis GN=klhdc10 PE=2 SV=1 326 456 1.0E-07
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 326 456 1.0E-07
sp|Q5RG82|NS1BA_DANRE Influenza virus NS1A-binding protein homolog A OS=Danio rerio GN=ivns1abpa PE=2 SV=1 220 417 1.0E-07
sp|Q67UX0|ADO2_ORYSJ Putative adagio-like protein 2 OS=Oryza sativa subsp. japonica GN=Os02g0150800 PE=3 SV=1 253 447 1.0E-07
sp|O49326|JAL21_ARATH Nitrile-specifier protein 2 OS=Arabidopsis thaliana GN=NSP2 PE=2 SV=1 178 407 2.0E-07
sp|Q5U3Y0|KLD10_RAT Kelch domain-containing protein 10 OS=Rattus norvegicus GN=Klhdc10 PE=2 SV=1 326 456 2.0E-07
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 326 456 2.0E-07
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 326 456 2.0E-07
sp|Q8TBB5|KLDC4_HUMAN Kelch domain-containing protein 4 OS=Homo sapiens GN=KLHDC4 PE=1 SV=1 306 465 2.0E-07
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 178 292 2.0E-07
sp|Q8N4N3|KLH36_HUMAN Kelch-like protein 36 OS=Homo sapiens GN=KLHL36 PE=1 SV=1 238 447 2.0E-07
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 196 401 2.0E-07
sp|O35709|ENC1_MOUSE Ectoderm-neural cortex protein 1 OS=Mus musculus GN=Enc1 PE=2 SV=2 178 447 2.0E-07
sp|Q3B7M1|KLH36_BOVIN Kelch-like protein 36 OS=Bos taurus GN=KLHL36 PE=2 SV=1 227 447 2.0E-07
sp|Q7M3S9|RNGB_DICDI RING finger protein B OS=Dictyostelium discoideum GN=rngB PE=2 SV=2 326 466 3.0E-07
sp|Q8VCH5|RABEK_MOUSE Rab9 effector protein with kelch motifs OS=Mus musculus GN=Rabepk PE=1 SV=2 206 447 3.0E-07
sp|Q9C9W9|ADO3_ARATH Adagio protein 3 OS=Arabidopsis thaliana GN=ADO3 PE=1 SV=1 159 396 3.0E-07
sp|Q6DFF7|KLH25_XENLA Kelch-like protein 25 OS=Xenopus laevis GN=klhl25 PE=2 SV=1 210 447 3.0E-07
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 216 428 4.0E-07
sp|Q0IIC2|KLD10_BOVIN Kelch domain-containing protein 10 OS=Bos taurus GN=KLHDC10 PE=2 SV=1 209 447 5.0E-07
sp|Q8RY71|ESP_ARATH Epithiospecifier protein OS=Arabidopsis thaliana GN=ESP PE=1 SV=2 160 396 5.0E-07
sp|Q6PID8|KLD10_HUMAN Kelch domain-containing protein 10 OS=Homo sapiens GN=KLHDC10 PE=1 SV=1 209 447 6.0E-07
sp|Q5Z8K3|ADO1_ORYSJ Adagio-like protein 1 OS=Oryza sativa subsp. japonica GN=Os06g0694000 PE=2 SV=1 206 396 6.0E-07
sp|Q0D2A9|KLH25_XENTR Kelch-like protein 25 OS=Xenopus tropicalis GN=klhl25 PE=2 SV=1 210 447 6.0E-07
sp|P60882|MEGF8_MOUSE Multiple epidermal growth factor-like domains protein 8 OS=Mus musculus GN=Megf8 PE=1 SV=2 261 435 6.0E-07
sp|Q9QYP0|MEGF8_RAT Multiple epidermal growth factor-like domains protein 8 OS=Rattus norvegicus GN=Megf8 PE=1 SV=2 261 435 7.0E-07
sp|Q9SDM9|JAL28_ARATH Nitrile-specifier protein 1 OS=Arabidopsis thaliana GN=NSP1 PE=2 SV=2 178 379 8.0E-07
sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 150 263 9.0E-07
sp|Q28DE7|KLD10_XENTR Kelch domain-containing protein 10 OS=Xenopus tropicalis GN=klhdc10 PE=2 SV=2 205 447 1.0E-06
sp|B0WWP2|KLHDB_CULQU Kelch-like protein diablo OS=Culex quinquefasciatus GN=dbo PE=3 SV=2 283 447 1.0E-06
sp|Q16RL8|KLHDB_AEDAE Kelch-like protein diablo OS=Aedes aegypti GN=dbo PE=3 SV=1 283 447 1.0E-06
sp|Q7QGL0|KLHDB_ANOGA Kelch-like protein diablo OS=Anopheles gambiae GN=dbo PE=3 SV=4 283 447 1.0E-06
sp|Q6AXB2|RABEK_XENLA Rab9 effector protein with kelch motifs OS=Xenopus laevis GN=rabepk PE=2 SV=1 210 447 2.0E-06
sp|Q9Y5Z7|HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens GN=HCFC2 PE=1 SV=1 163 360 2.0E-06
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 151 305 2.0E-06
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with kelch motifs OS=Rattus norvegicus GN=Rabepk PE=2 SV=1 206 447 2.0E-06
sp|Q8W420|ADO2_ARATH Adagio protein 2 OS=Arabidopsis thaliana GN=ADO2 PE=1 SV=1 261 465 2.0E-06
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 163 360 3.0E-06
sp|Q6PAR0|KLD10_MOUSE Kelch domain-containing protein 10 OS=Mus musculus GN=Klhdc10 PE=1 SV=1 209 447 3.0E-06
sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 210 397 3.0E-06
sp|Q94BT6|ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana GN=ADO1 PE=1 SV=2 196 396 3.0E-06
sp|A1ZB86|KLD10_DROME Kelch domain-containing protein 10 homolog OS=Drosophila melanogaster GN=slim PE=1 SV=1 155 451 4.0E-06
sp|B4QLQ2|KLHDB_DROSI Kelch-like protein diablo OS=Drosophila simulans GN=dbo PE=3 SV=1 283 447 4.0E-06
sp|Q8W4K1|TYW23_ARATH tRNA wybutosine-synthesizing protein 2/3/4 OS=Arabidopsis thaliana GN=At4g04670 PE=2 SV=1 376 471 5.0E-06
sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 153 361 6.0E-06
sp|Q5RKG2|HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus GN=Hcfc2 PE=2 SV=1 216 428 6.0E-06
sp|B3M9V8|KLHDB_DROAN Kelch-like protein diablo OS=Drosophila ananassae GN=dbo PE=3 SV=2 283 447 6.0E-06
sp|B4GRJ2|KLHDB_DROPE Kelch-like protein diablo OS=Drosophila persimilis GN=dbo PE=3 SV=1 283 447 7.0E-06
sp|Q8R124|KLH36_MOUSE Kelch-like protein 36 OS=Mus musculus GN=Klhl36 PE=1 SV=1 227 447 7.0E-06
sp|Q2M0J9|KLHDB_DROPS Kelch-like protein diablo OS=Drosophila pseudoobscura pseudoobscura GN=dbo PE=3 SV=2 283 447 7.0E-06
sp|P51611|HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus GN=HCFC1 PE=1 SV=1 315 447 8.0E-06
sp|Q2T9Z7|KLHL9_BOVIN Kelch-like protein 9 OS=Bos taurus GN=KLHL9 PE=2 SV=1 274 450 8.0E-06
sp|D2HEW7|KLH22_AILME Kelch-like protein 22 OS=Ailuropoda melanoleuca GN=KLHL22 PE=3 SV=1 278 449 8.0E-06
sp|B4PD06|KLHDB_DROYA Kelch-like protein diablo OS=Drosophila yakuba GN=dbo PE=3 SV=1 283 447 8.0E-06
sp|B4HIK1|KLHDB_DROSE Kelch-like protein diablo OS=Drosophila sechellia GN=dbo PE=3 SV=1 283 447 8.0E-06
sp|Q9VUU5|KLHDB_DROME Kelch-like protein diablo OS=Drosophila melanogaster GN=dbo PE=1 SV=1 283 447 8.0E-06
sp|B3NDN0|KLHDB_DROER Kelch-like protein diablo OS=Drosophila erecta GN=dbo PE=3 SV=1 283 447 8.0E-06
sp|Q61191|HCFC1_MOUSE Host cell factor 1 OS=Mus musculus GN=Hcfc1 PE=1 SV=2 315 447 9.0E-06
sp|Q66HD2|KLH36_RAT Kelch-like protein 36 OS=Rattus norvegicus GN=Klhl36 PE=2 SV=1 227 447 9.0E-06
sp|P51610|HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 315 447 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|002870
MSFFSRRKHSQPQPAVIPNVTVAQLPSQALAQVSTNRSRDAAINQAGSQRDDSANEITTPTQRTRGGSPSTAGLQ
SSNSLQAQAPQAQPYAQPPSRLQHPPQQQLQQQSQQPPQQPPQQPPVQRPSAYPWSHRRLILLPPSVKPDRIEEI
SAPTIPSPSPFPRYGHALPATTTNSGDLYIFGGLVRESARNDLYLFSTKENAATLLQTGGEIPSPRVGHASSLIS
NVLIVWGGDTKTEASSRGNDPHDDGLYLLNLVSRDWTRVTVHGPAPIGRYGHAVAIVGTVFFVFGGQVDGAFLDD
VWAFDLNTLRTRAAWERYDPTSPERPARRTGHICVPYQDKLVIFGGTDGQYHYNDIWSFDLKARRWSELQCIGHI
PSPREGHAAAIVDDVIYVFGGRGVDGKDLGDLAAFKISKQRWFRFENMGPTPSGRSGHAMASTGTKIFVLGGESF
VPFKTDDSDFIYVLDSKHIKYPPPDAPGLDRKSAAPTQSHQPSQINGRPMSPEVEDLRNRTMSPTNGMPQQALAS
NNKGKAPVRPRREDEVTDEGIDTGTAESFSHREHAASPDQHQVRQQQQPQQRGKSPQSGSNSRTVSPNGDLHESR
QQPNIVGVIGGQVGTNDSGRGSPAIAERMSPATGNTGRSSPAIVDRSRSQSDTYAGSQNGSPSPNGGFPRINGSV
GSVAADLVKDLKSKDAELDSLKRQMSWMKEALSKATKAGYILSDRQATSDSISHGGFDSSIDDRGELLLKFKQFR
AEVQATMAEQARQASERIAEAESLKTSATQEAAFYRSKLAAFEANSDADVSRIERDRIAYLEQNMTDLMGQRWVQ
DRKIGELNEELVLQTTLCQQAVIRAEDALKCSEMSEENHKRAVKLHTELQEKHKILEVNHREHSDRFVAQSSMLE
QKEAEVMTLRTQLDELTRTRDQHVRALDQAKVALQAASARAEEVDALYQRARDQNTDHERIIAEMRGELETLTAD
AEAARARLTDVETSWAKSREEADALRAFTTGSLGQLLDTHRDLRTDEDRIARGYDAKVEALQDEAQNLRMRLKEA
DEKVDEVLHRLEEEGKAVSEQRTEQASLRAQVVTLRGQLSNALADAGGLRKDLSNREVSMKEKVKEATDTNMKLA
MLRSYLNENGISINEDEIRSSSRGYQSPSPMVIDLENKLAEKSKQYEHTERELAQVWRRTREAEAQINALTNELG
RMRTNSRTGGIGSDDDARVQEAERKLLEAEQNHLVRVRQVEDDYRLAVRGTEKLMRKMGEELKNQKAINNQLSQE
LEIARSGRAMRSVNGRTTPSEDESSRQLIEAQRQVQRLLLDNKELRSRTQALEKDMELLRDSLVATQRESDDRLS
QVEDLQYDIERLKESLVIARGGHSESLLESLNKDNANLRRQNEELSRKIEILLDVDRPGFGDRPISDISGQRASL
SSGSDNALVFEHLSSEFDDWQRHLAASSMSHRRQMSDMESDPTIADRARSPRS*
Coding >AgabiH97|002870
ATGTCCTTCTTCTCTAGGAGGAAGCACAGCCAACCCCAACCTGCTGTTATTCCCAATGTAACCGTCGCACAACTA
CCCAGTCAGGCTCTTGCGCAAGTCTCCACTAATCGCTCTCGGGATGCGGCCATAAACCAGGCAGGCAGTCAACGT
GATGATTCCGCGAATGAAATCACGACTCCTACTCAACGCACCAGAGGCGGTAGCCCGTCAACTGCTGGCCTACAG
AGCTCGAACTCGTTGCAAGCCCAAGCGCCTCAAGCTCAACCATATGCTCAACCTCCATCCCGTCTACAACATCCC
CCTCAACAACAACTTCAGCAGCAAAGTCAACAACCACCTCAACAGCCACCTCAACAGCCGCCCGTACAGCGCCCT
TCGGCTTATCCATGGTCGCACCGTCGCCTCATTCTCTTACCACCTTCAGTCAAACCAGACAGAATTGAAGAAATT
TCTGCACCGACGATCCCCTCACCTTCCCCATTTCCTCGTTATGGTCATGCACTTCCAGCCACGACGACTAATAGC
GGGGACCTCTATATTTTTGGTGGTCTTGTACGAGAGTCCGCACGTAACGACCTTTACCTCTTTTCGACCAAGGAG
AATGCTGCTACACTCCTGCAGACGGGTGGTGAAATCCCGAGTCCTAGAGTTGGGCACGCGAGTTCTTTAATTAGC
AACGTCCTTATTGTGTGGGGCGGGGATACTAAAACCGAGGCTTCGAGTCGCGGGAATGACCCTCATGATGATGGT
CTATATTTGTTGAACCTTGTTTCTCGTGATTGGACAAGGGTAACGGTACATGGGCCAGCTCCCATTGGCCGCTAT
GGACATGCTGTCGCTATTGTTGGCACCGTCTTTTTCGTGTTCGGTGGCCAAGTTGATGGCGCCTTCTTGGACGAC
GTTTGGGCTTTTGATTTGAACACATTGCGTACGAGAGCAGCTTGGGAGCGCTATGATCCAACGTCCCCTGAAAGG
CCTGCCAGACGCACGGGCCATATCTGTGTCCCGTACCAGGATAAGCTTGTCATCTTTGGCGGAACGGATGGGCAG
TATCACTATAATGACATATGGTCGTTTGATCTGAAAGCACGGAGGTGGTCGGAACTGCAGTGTATTGGGCACATT
CCGTCCCCACGAGAGGGTCATGCTGCTGCCATCGTTGATGACGTTATATACGTTTTTGGCGGGCGAGGTGTTGAT
GGTAAAGATTTGGGTGACCTTGCGGCGTTTAAGATTTCTAAGCAACGATGGTTCAGGTTCGAGAATATGGGACCT
ACCCCGAGTGGTCGATCAGGTCACGCCATGGCGTCCACGGGTACCAAGATTTTCGTACTTGGTGGAGAATCATTT
GTACCGTTCAAAACAGATGACTCAGATTTCATCTACGTCCTCGACAGTAAACATATCAAATATCCTCCTCCCGAT
GCACCTGGGCTTGACCGTAAGTCAGCTGCCCCTACTCAGAGTCATCAGCCTTCGCAAATCAATGGACGCCCCATG
TCTCCTGAAGTCGAGGATCTTCGAAATAGGACGATGTCACCCACCAATGGCATGCCCCAGCAGGCTTTGGCGAGC
AACAATAAAGGCAAAGCCCCTGTGAGGCCTCGGCGAGAGGACGAGGTCACAGATGAAGGCATTGACACCGGCACC
GCGGAATCTTTTTCTCATCGAGAGCATGCCGCTTCTCCAGATCAACATCAGGTTCGGCAACAACAACAGCCCCAG
CAACGGGGCAAGAGTCCACAAAGTGGAAGCAATAGCCGCACTGTCTCACCAAATGGCGACTTGCATGAGTCTCGC
CAGCAGCCCAACATCGTTGGTGTTATCGGTGGACAAGTGGGTACGAACGACTCTGGGCGCGGTTCGCCAGCTATT
GCAGAGCGCATGTCTCCTGCCACCGGCAATACTGGACGCAGTTCACCTGCTATCGTTGATCGATCCAGGTCTCAG
TCTGATACTTATGCTGGGTCGCAAAATGGATCTCCGTCACCCAATGGTGGTTTCCCGCGCATTAATGGGTCGGTT
GGAAGTGTTGCTGCAGATCTAGTGAAGGATCTGAAGTCAAAAGACGCGGAACTAGACAGCCTGAAGAGACAAATG
TCGTGGATGAAAGAAGCGTTATCAAAAGCCACCAAGGCTGGGTATATTCTATCAGATAGACAAGCTACATCCGAT
TCTATATCTCATGGTGGATTTGACTCGAGTATTGACGATCGCGGAGAATTGCTGCTTAAGTTCAAACAGTTTAGG
GCAGAAGTACAGGCTACCATGGCAGAGCAGGCTAGACAAGCTTCTGAACGTATTGCAGAAGCTGAAAGTCTCAAG
ACTAGTGCGACGCAAGAAGCCGCTTTTTATCGATCAAAGCTGGCCGCCTTCGAGGCTAACAGTGATGCCGATGTT
TCGCGGATAGAGCGCGATCGTATCGCGTACCTCGAGCAGAACATGACAGACCTCATGGGACAGCGGTGGGTACAA
GATCGTAAGATAGGCGAACTGAACGAGGAATTGGTGCTTCAAACCACGCTCTGCCAACAAGCCGTAATTCGTGCC
GAGGACGCTCTCAAATGCTCGGAAATGTCAGAAGAAAACCATAAACGTGCCGTAAAATTGCATACCGAACTCCAG
GAAAAGCACAAGATTCTAGAAGTGAACCACCGTGAGCACAGTGATCGTTTCGTGGCGCAAAGTTCGATGTTGGAA
CAAAAAGAAGCAGAGGTGATGACGCTCAGAACACAGCTTGATGAACTTACACGTACAAGAGACCAACATGTACGA
GCGCTCGATCAAGCTAAAGTCGCTTTACAAGCGGCTTCGGCACGGGCTGAGGAGGTCGACGCATTGTATCAGCGC
GCTCGCGATCAGAATACCGACCACGAGCGGATCATCGCGGAGATGAGAGGTGAACTTGAGACACTGACTGCTGAT
GCGGAGGCTGCGCGAGCAAGGTTGACGGACGTTGAAACTTCTTGGGCCAAATCTCGTGAAGAGGCTGATGCATTA
CGGGCATTCACAACGGGTAGTCTGGGTCAACTTTTGGACACTCATCGAGATTTGAGAACGGATGAAGATAGAATT
GCGCGAGGATATGATGCGAAGGTGGAAGCCTTGCAGGATGAGGCCCAGAACTTGAGAATGAGGTTGAAAGAGGCG
GATGAAAAGGTTGATGAGGTGCTTCACCGGTTAGAGGAAGAGGGAAAAGCGGTTTCGGAGCAACGAACCGAACAG
GCATCGCTGAGAGCACAGGTTGTAACCCTCCGCGGCCAATTATCGAATGCCCTCGCAGACGCTGGTGGTCTTCGC
AAAGATCTTTCAAATAGAGAAGTCTCGATGAAAGAGAAAGTCAAAGAAGCGACGGACACGAACATGAAACTGGCA
ATGCTCAGGAGCTATCTCAACGAGAATGGAATTAGTATCAATGAGGATGAGATCCGATCGTCATCTAGGGGATAC
CAATCGCCTTCACCTATGGTGATTGATTTAGAAAACAAGCTTGCTGAGAAATCAAAACAATATGAGCACACGGAG
CGGGAGCTAGCACAGGTGTGGAGAAGAACAAGGGAGGCTGAAGCACAAATCAACGCCTTGACGAATGAATTGGGA
CGAATGCGAACAAATTCCAGGACTGGTGGTATAGGAAGCGATGACGATGCCCGTGTTCAGGAAGCAGAACGTAAG
TTGTTAGAGGCGGAACAAAATCATTTAGTTCGCGTTCGTCAAGTGGAAGATGATTATCGACTTGCTGTGCGGGGC
ACCGAAAAATTGATGAGGAAGATGGGCGAGGAACTCAAGAACCAGAAAGCTATCAACAATCAACTCTCGCAGGAG
CTTGAAATTGCCAGGAGTGGTCGGGCAATGCGTAGCGTTAACGGTCGTACAACACCATCCGAGGATGAATCGTCG
CGGCAACTTATCGAAGCTCAGCGCCAGGTGCAGCGCTTACTCCTCGATAACAAGGAGCTCCGCTCCCGCACACAG
GCCTTAGAGAAAGACATGGAGCTTTTGCGAGATTCGCTAGTTGCCACGCAGCGCGAATCTGATGATCGCCTCAGT
CAGGTCGAAGACCTTCAGTATGACATTGAAAGGCTCAAGGAGTCACTTGTTATTGCTCGTGGCGGACACAGTGAA
AGTCTGTTGGAGAGCCTCAACAAAGACAATGCCAACCTACGGAGACAAAACGAAGAGCTCTCGCGCAAGATTGAA
ATCTTACTTGACGTCGATCGTCCAGGCTTTGGTGATCGACCCATATCTGATATTTCTGGACAACGAGCTAGTTTA
TCATCAGGTTCAGACAATGCGCTGGTATTTGAACATCTCTCTAGTGAATTTGATGACTGGCAGCGGCATCTGGCC
GCAAGTTCGATGAGTCATCGACGACAGATGAGCGACATGGAGAGCGATCCGACTATTGCCGACAGAGCGCGATCC
CCGCGATCATAA
Transcript >AgabiH97|002870
ATGTCCTTCTTCTCTAGGAGGAAGCACAGCCAACCCCAACCTGCTGTTATTCCCAATGTAACCGTCGCACAACTA
CCCAGTCAGGCTCTTGCGCAAGTCTCCACTAATCGCTCTCGGGATGCGGCCATAAACCAGGCAGGCAGTCAACGT
GATGATTCCGCGAATGAAATCACGACTCCTACTCAACGCACCAGAGGCGGTAGCCCGTCAACTGCTGGCCTACAG
AGCTCGAACTCGTTGCAAGCCCAAGCGCCTCAAGCTCAACCATATGCTCAACCTCCATCCCGTCTACAACATCCC
CCTCAACAACAACTTCAGCAGCAAAGTCAACAACCACCTCAACAGCCACCTCAACAGCCGCCCGTACAGCGCCCT
TCGGCTTATCCATGGTCGCACCGTCGCCTCATTCTCTTACCACCTTCAGTCAAACCAGACAGAATTGAAGAAATT
TCTGCACCGACGATCCCCTCACCTTCCCCATTTCCTCGTTATGGTCATGCACTTCCAGCCACGACGACTAATAGC
GGGGACCTCTATATTTTTGGTGGTCTTGTACGAGAGTCCGCACGTAACGACCTTTACCTCTTTTCGACCAAGGAG
AATGCTGCTACACTCCTGCAGACGGGTGGTGAAATCCCGAGTCCTAGAGTTGGGCACGCGAGTTCTTTAATTAGC
AACGTCCTTATTGTGTGGGGCGGGGATACTAAAACCGAGGCTTCGAGTCGCGGGAATGACCCTCATGATGATGGT
CTATATTTGTTGAACCTTGTTTCTCGTGATTGGACAAGGGTAACGGTACATGGGCCAGCTCCCATTGGCCGCTAT
GGACATGCTGTCGCTATTGTTGGCACCGTCTTTTTCGTGTTCGGTGGCCAAGTTGATGGCGCCTTCTTGGACGAC
GTTTGGGCTTTTGATTTGAACACATTGCGTACGAGAGCAGCTTGGGAGCGCTATGATCCAACGTCCCCTGAAAGG
CCTGCCAGACGCACGGGCCATATCTGTGTCCCGTACCAGGATAAGCTTGTCATCTTTGGCGGAACGGATGGGCAG
TATCACTATAATGACATATGGTCGTTTGATCTGAAAGCACGGAGGTGGTCGGAACTGCAGTGTATTGGGCACATT
CCGTCCCCACGAGAGGGTCATGCTGCTGCCATCGTTGATGACGTTATATACGTTTTTGGCGGGCGAGGTGTTGAT
GGTAAAGATTTGGGTGACCTTGCGGCGTTTAAGATTTCTAAGCAACGATGGTTCAGGTTCGAGAATATGGGACCT
ACCCCGAGTGGTCGATCAGGTCACGCCATGGCGTCCACGGGTACCAAGATTTTCGTACTTGGTGGAGAATCATTT
GTACCGTTCAAAACAGATGACTCAGATTTCATCTACGTCCTCGACAGTAAACATATCAAATATCCTCCTCCCGAT
GCACCTGGGCTTGACCGTAAGTCAGCTGCCCCTACTCAGAGTCATCAGCCTTCGCAAATCAATGGACGCCCCATG
TCTCCTGAAGTCGAGGATCTTCGAAATAGGACGATGTCACCCACCAATGGCATGCCCCAGCAGGCTTTGGCGAGC
AACAATAAAGGCAAAGCCCCTGTGAGGCCTCGGCGAGAGGACGAGGTCACAGATGAAGGCATTGACACCGGCACC
GCGGAATCTTTTTCTCATCGAGAGCATGCCGCTTCTCCAGATCAACATCAGGTTCGGCAACAACAACAGCCCCAG
CAACGGGGCAAGAGTCCACAAAGTGGAAGCAATAGCCGCACTGTCTCACCAAATGGCGACTTGCATGAGTCTCGC
CAGCAGCCCAACATCGTTGGTGTTATCGGTGGACAAGTGGGTACGAACGACTCTGGGCGCGGTTCGCCAGCTATT
GCAGAGCGCATGTCTCCTGCCACCGGCAATACTGGACGCAGTTCACCTGCTATCGTTGATCGATCCAGGTCTCAG
TCTGATACTTATGCTGGGTCGCAAAATGGATCTCCGTCACCCAATGGTGGTTTCCCGCGCATTAATGGGTCGGTT
GGAAGTGTTGCTGCAGATCTAGTGAAGGATCTGAAGTCAAAAGACGCGGAACTAGACAGCCTGAAGAGACAAATG
TCGTGGATGAAAGAAGCGTTATCAAAAGCCACCAAGGCTGGGTATATTCTATCAGATAGACAAGCTACATCCGAT
TCTATATCTCATGGTGGATTTGACTCGAGTATTGACGATCGCGGAGAATTGCTGCTTAAGTTCAAACAGTTTAGG
GCAGAAGTACAGGCTACCATGGCAGAGCAGGCTAGACAAGCTTCTGAACGTATTGCAGAAGCTGAAAGTCTCAAG
ACTAGTGCGACGCAAGAAGCCGCTTTTTATCGATCAAAGCTGGCCGCCTTCGAGGCTAACAGTGATGCCGATGTT
TCGCGGATAGAGCGCGATCGTATCGCGTACCTCGAGCAGAACATGACAGACCTCATGGGACAGCGGTGGGTACAA
GATCGTAAGATAGGCGAACTGAACGAGGAATTGGTGCTTCAAACCACGCTCTGCCAACAAGCCGTAATTCGTGCC
GAGGACGCTCTCAAATGCTCGGAAATGTCAGAAGAAAACCATAAACGTGCCGTAAAATTGCATACCGAACTCCAG
GAAAAGCACAAGATTCTAGAAGTGAACCACCGTGAGCACAGTGATCGTTTCGTGGCGCAAAGTTCGATGTTGGAA
CAAAAAGAAGCAGAGGTGATGACGCTCAGAACACAGCTTGATGAACTTACACGTACAAGAGACCAACATGTACGA
GCGCTCGATCAAGCTAAAGTCGCTTTACAAGCGGCTTCGGCACGGGCTGAGGAGGTCGACGCATTGTATCAGCGC
GCTCGCGATCAGAATACCGACCACGAGCGGATCATCGCGGAGATGAGAGGTGAACTTGAGACACTGACTGCTGAT
GCGGAGGCTGCGCGAGCAAGGTTGACGGACGTTGAAACTTCTTGGGCCAAATCTCGTGAAGAGGCTGATGCATTA
CGGGCATTCACAACGGGTAGTCTGGGTCAACTTTTGGACACTCATCGAGATTTGAGAACGGATGAAGATAGAATT
GCGCGAGGATATGATGCGAAGGTGGAAGCCTTGCAGGATGAGGCCCAGAACTTGAGAATGAGGTTGAAAGAGGCG
GATGAAAAGGTTGATGAGGTGCTTCACCGGTTAGAGGAAGAGGGAAAAGCGGTTTCGGAGCAACGAACCGAACAG
GCATCGCTGAGAGCACAGGTTGTAACCCTCCGCGGCCAATTATCGAATGCCCTCGCAGACGCTGGTGGTCTTCGC
AAAGATCTTTCAAATAGAGAAGTCTCGATGAAAGAGAAAGTCAAAGAAGCGACGGACACGAACATGAAACTGGCA
ATGCTCAGGAGCTATCTCAACGAGAATGGAATTAGTATCAATGAGGATGAGATCCGATCGTCATCTAGGGGATAC
CAATCGCCTTCACCTATGGTGATTGATTTAGAAAACAAGCTTGCTGAGAAATCAAAACAATATGAGCACACGGAG
CGGGAGCTAGCACAGGTGTGGAGAAGAACAAGGGAGGCTGAAGCACAAATCAACGCCTTGACGAATGAATTGGGA
CGAATGCGAACAAATTCCAGGACTGGTGGTATAGGAAGCGATGACGATGCCCGTGTTCAGGAAGCAGAACGTAAG
TTGTTAGAGGCGGAACAAAATCATTTAGTTCGCGTTCGTCAAGTGGAAGATGATTATCGACTTGCTGTGCGGGGC
ACCGAAAAATTGATGAGGAAGATGGGCGAGGAACTCAAGAACCAGAAAGCTATCAACAATCAACTCTCGCAGGAG
CTTGAAATTGCCAGGAGTGGTCGGGCAATGCGTAGCGTTAACGGTCGTACAACACCATCCGAGGATGAATCGTCG
CGGCAACTTATCGAAGCTCAGCGCCAGGTGCAGCGCTTACTCCTCGATAACAAGGAGCTCCGCTCCCGCACACAG
GCCTTAGAGAAAGACATGGAGCTTTTGCGAGATTCGCTAGTTGCCACGCAGCGCGAATCTGATGATCGCCTCAGT
CAGGTCGAAGACCTTCAGTATGACATTGAAAGGCTCAAGGAGTCACTTGTTATTGCTCGTGGCGGACACAGTGAA
AGTCTGTTGGAGAGCCTCAACAAAGACAATGCCAACCTACGGAGACAAAACGAAGAGCTCTCGCGCAAGATTGAA
ATCTTACTTGACGTCGATCGTCCAGGCTTTGGTGATCGACCCATATCTGATATTTCTGGACAACGAGCTAGTTTA
TCATCAGGTTCAGACAATGCGCTGGTATTTGAACATCTCTCTAGTGAATTTGATGACTGGCAGCGGCATCTGGCC
GCAAGTTCGATGAGTCATCGACGACAGATGAGCGACATGGAGAGCGATCCGACTATTGCCGACAGAGCGCGATCC
CCGCGATCATAA
Gene >AgabiH97|002870
ATGTCCTTCTTCTCTAGGAGGAAGCACAGCCAACCCCAACCTGCTGTTATTCCCAATGTAACCGTCGCACAACTA
CCCAGTCAGGCTCTTGCGCAAGTCTCCACTAATCGCTCTCGGGATGCGGCCATAAACCAGGCAGGCAGTCAACGT
GATGATTCCGCGAATGAAATGTGTGTATACCTAGTCTCGGAGATCCTCTTCCACTTGTTTTATCCTCATGCTTGT
CCTTTCTTGGTAGCACGACTCCTACTCAACGCACCAGAGGCGGTAGCCCGTCAACTGCTGGCCTACAGAGCTCGA
ACTCGTTGCAAGCCCAAGCGCCTCAAGCTCAACCATATGCTCAACCTCCATCCCGTCTACAACATCCCCCTCAAC
AACAACTTCAGCAGCAAAGTCAACAACCACCTCAACAGCCACCTCAACAGCCGCCCGTACAGCGCCCTTCGGCTT
ATCCATGGTCGCACCGTCGCCTCATTCTCTTACCACCTTCAGTCAAACCAGACAGAATTGAAGAAATTTCTGCAC
CGACGATCCCCTCACCTTCCCCATTTCCTCGTTATGGTCATGCACTTCCAGCCACGACGACTAATAGCGGGGACC
TCTATATTTTTGGTGGTCTTGTACGAGAGTCCGCACGTAACGACCTTTACCTCTTTTCGACCAAGGAGAATGCTG
CTACACTCCTGCAGACGGGTGGTGAAATCCCGAGTCCTAGAGTTGGGCACGCGAGTTCTTTAATTAGCAACGTCC
TTATTGTGTGGGGCGGGGATACTAAAACCGAGGCTTCGAGTCGCGGGAATGACCCTCATGATGATGGTCTATATT
TGTTGAACCTTGGTGCGTATTCAATTTTGTTTCTGATGTCAAAGTACCGACCCTGGTTTTAGTTTCTCGTGATTG
GACAAGGGTAACGGTACATGGGCCAGCTCCCATTGGCCGCTATGGACATGCTGTCGCTATTGTTGGCACCGTCTT
TTTCGTGTTCGGTGGCCAAGTTGATGGCGCCTTCTTGGACGACGTTTGGGCTTTTGATTTGAACACATGTAAGTT
TGAGTGCTCATCCTTTGCTTGCCAATTAAACTTATTGATTCTCGGTCCTAGTGCGTACGAGAGCAGCTTGGGAGC
GCTATGATCCAACGTCCCCTGAAAGGCCTGCCAGACGCACGGGCCATATCTGTGTCCCGTACCAGGATAAGCTTG
TCATGTATGCCTACCTGTCGAGGACAATTAACTATGGCTGACACCTTCGATTTGTCTTTTAATAGCTTTGGCGGA
ACGGATGGGCAGTATCACTATAATGACATATGGTCGTTTGATCTGAAAGCACGGAGGTGGTCGGAACTGCAGTGT
ATTGGGCACATTCCGTCCCCACGAGAGGGTCATGCTGCTGCCATCGTTGATGACGTTATATACGTTTTTGGCGGG
CGAGGTGTTGATGGTAAAGATTTGGGTGACCTTGCGGCGTTTAAGATTTCTAGTGCGTCTAATTTCGTTTGACCC
GCGTATCATACCCTGATTGAGTGTCTGGTAGAGCAACGATGGTTCAGGTTCGAGAATATGGGACCTACCCCGAGT
GGTCGATCAGGTCACGCCATGGCGTCCACGGGTACCAAGATTTTCGTACTTGGTGGAGAATCATTTGTACCGTTC
AAAACAGATGACTCAGATTTCATCTACGTCCTCGACAGTAGTCAGTATCATACCCACCATGTTGATACACCCGGT
TCGCTGACACTCCACGATGCAGAACATATCAAATATCCTCCTCCCGATGCACCTGGGCTTGACCGTAAGTCAGCT
GCCCCTACTCAGAGTCATCAGCCTTCGCAAATCAATGGACGCCCCATGTCTCCTGAAGTCGAGGATCTTCGAAAT
AGGACGATGTCACCCACCAATGGCATGCCCCAGCAGGCTTTGGCGAGCAACAATAAAGGCAAAGCCCCTGTGAGG
CCTCGGCGAGAGGACGAGGTCACAGATGAAGGCATTGACACCGGCACCGCGGAATCTTTTTCTCATCGAGAGCAT
GCCGCTTCTCCAGATCAACATCAGGTTCGGCAACAACAACAGCCCCAGCAACGGGGCAAGAGTCCACAAAGTGGA
AGCAATAGCCGCACTGTCTCACCAAATGGCGACTTGCATGAGTCTCGCCAGCAGCCCAACATCGTTGGTGTTATC
GGTGGACAAGTGGGTACGAACGACTCTGGGCGCGGTTCGCCAGCTATTGCAGAGCGCATGTCTCCTGCCACCGGC
AATACTGGACGCAGTTCACCTGCTATCGTTGATCGATCCAGGTCTCAGTCTGATACTTATGCTGGGTCGCAAAAT
GGATCTCCGTCACCCAATGGTGGTTTCCCGCGCATTAATGGGTCGGTTGGAAGTGTTGCTGCAGATCTAGTGAAG
GATCTGAAGTCAAAAGACGCGGAACTAGACAGCCTGAAGAGACAAATGTCGTGGATGAAAGAAGCGTTATCAAAA
GCCACCAAGGCTGGGTATATTCTATCAGATAGACAAGCTACATCCGATTCTATATCTCATGGTGGATTTGACTCG
AGTATTGACGATCGCGGAGAATTGCTGCTTAAGTTCAAACAGTTTAGGGCAGAAGTACAGGTAACTTATTTTTGC
GCTTTCTTAGGTGAATACTGACTCGACTTTGCAAGGCTACCATGGCAGAGCAGGCTAGACAAGCTTCTGAACGTA
TTGCAGAAGCTGAAAGTCTCAAGACTAGTGCGACGCAAGAAGCCGCTTTTTATCGATCAAAGCTGGCCGCCTTCG
AGGCTAACAGTGATGCCGATGTTTCGCGGATAGAGCGCGATCGTATCGCGTACCTCGAGCAGAACATGACAGACC
TCATGGGACAGCGGTGGGTACAAGATCGTAAGATAGGCGAACTGAACGAGGAATTGGTGCTTCAAACCACGCTCT
GCCAACAAGCCGTAATTCGTGCCGAGGACGCTCTCAAATGCTCGGAAATGTCAGAAGAAAACCATAAACGTGCCG
TAAAATTGCATACCGAACTCCAGGAAAAGCACAAGATTCTAGAAGTGAACCACCGTGAGCACAGTGATCGTTTCG
TGGCGCAAAGTTCGATGTTGGAACAAAAAGAAGCAGAGGTGATGACGCTCAGAACACAGCTTGATGAACTTACAC
GTACAAGAGACCAACATGTACGAGCGCTCGATCAAGCTAAAGTCGCTTTACAAGCGGCTTCGGCACGGGCTGAGG
AGGTCGACGCATTGTATCAGCGCGCTCGCGATCAGAATACCGACCACGAGCGGATCATCGCGGAGATGAGAGGTG
AACTTGAGACACTGACTGCTGATGCGGAGGCTGCGCGAGCAAGGTTGACGGACGTTGAAACTTCTTGGGCCAAAT
CTCGTGAAGAGGCTGATGCATTACGGGCATTCACAACGGGTAGTCTGGGTCAACTTTTGGACACTCATCGAGATT
TGAGAACGGATGAAGATAGAATTGCGCGAGGATATGATGCGAAGGTGGAAGCCTTGCAGGATGAGGCCCAGAACT
TGAGAATGAGGTTGAAAGAGGCGGATGAAAAGGTTGATGAGGTGCTTCACCGGTTAGAGGAAGAGGGAAAAGCGG
TTTCGGAGCAACGAACCGAACAGGCATCGCTGAGAGCACAGGTTGTAACCCTCCGCGGCCAATTATCGAATGCCC
TCGCAGACGCTGGTGGTCTTCGCAAAGATCTTTCAAATAGAGAAGTCTCGATGAAAGAGAAAGTCAAAGAAGCGA
CGGACACGAACATGAAACTGGCAATGCTCAGGAGCTATCTCAACGAGAATGGAATTAGTATCAATGAGGATGAGA
TCCGATCGTCATCTAGGGGATACCAATCGCCTTCACCTATGGTGATTGATTTAGAAAACAAGCTTGCTGAGAAAT
CAAAACAATATGAGCACACGGAGCGGGAGCTAGCACAGGTGTGGAGAAGAACAAGGGAGGCTGAAGCACAAATCA
ACGCCTTGACGAATGAATTGGGACGAATGCGAACAAATTCCAGGACTGGTGGTATAGGAAGCGATGACGATGCCC
GTGTTCAGGAAGCAGAACGTAAGTTGTTAGAGGCGGAACAAAATCATTTAGTTCGCGTTCGTCAAGTGGAAGATG
ATTATCGACTTGCTGTGCGGTACGTCAAGTAAGTTTTCGCATTAAATTTTGCAACGCCGTTGACGAATTTTCGCA
TCTCTTTCATAATCAAGGGGCACCGAAAAATTGATGAGGAAGATGGGCGAGGAACTCAAGAACCAGAAAGCTATC
AACAATCAACTCTCGCAGGAGCTTGAAATTGCCAGGAGTGGTCGGGCAATGCGTAGCGTTAACGGTCGTACAACA
CCATCCGAGGATGAATCGTCGCGGCAACTTATCGAAGCTCAGCGCCAGGTGCAGCGCTTACTCCTCGATAACAAG
GAGCTCCGCTCCCGCACACAGGCCTTAGAGAAAGACATGGAGCTTTTGCGAGATTCGCTAGTTGCCACGCAGCGC
GAATCTGATGATCGCCTCAGTCAGGTCGAAGACCTTCAGTATGACATTGAAAGGCTCAAGGAGTCACTTGTTATT
GCTCGTGGCGGACACAGTGAAAGTCTGTTGGAGAGCCTCAACAAAGACAATGCCAACCTACGGAGACAAAACGAA
GAGCTCTCGCGCAAGATTGAAATCTTACTTGACGTCGATCGTCCAGGCTTTGGTGATCGACCCATATCTGATATT
TCTGGACAACGAGCTAGTTTATCATCAGGTTCAGACAATGCGCTGGTATTTGAACATCTCTCTAGTGAATTTGAT
GACTGGCAGCGGCATCTGGCCGCAAGTTCGATGAGTCATCGACGACAGATGAGCGACATGGAGAGCGATCCGACT
ATTGCCGACAGAGCGCGATCCCCGCGATCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail