Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|002850
Gene name
Locationscaffold_1:723939..724511
Strand+
Gene length (bp)572
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01185 Hydrophobin Fungal hydrophobin 4.8E-06 86 135

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005199 structural constituent of cell wall Yes
GO:0009277 fungal-type cell wall Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005618 cell wall No
GO:0030312 external encapsulating structure No
GO:0005198 structural molecule activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|002850
MNFKFLALIAFATAVIAAPASEDVLADFSDPHPGAPETAGTRLSTSARDDLVQTESYQARPNSYDPRQDPSQDAI
AALLALGNYSGLTFDPATTSPMIGLECIPFDELFGTCSSTPVCCNNIEPTGRLAIGCRPLSFS*
Coding >AgabiH97|002850
ATGAACTTCAAGTTCCTCGCCCTCATTGCCTTCGCTACCGCAGTCATTGCCGCTCCCGCTTCTGAAGATGTTCTG
GCCGACTTCAGCGACCCCCACCCCGGAGCTCCTGAAACTGCTGGCACTCGACTCAGCACTTCAGCAAGAGACGAT
CTTGTTCAAACTGAATCCTATCAAGCTCGCCCCAACTCGTATGATCCCCGCCAGGACCCCAGTCAAGATGCCATA
GCAGCACTGCTCGCCTTGGGGAATTATTCCGGTCTTACCTTCGATCCCGCTACCACTTCCCCCATGATTGGGTTG
GAATGTATTCCTTTCGACGAGCTCTTTGGTACCTGCTCCTCGACGCCCGTTTGTTGTAATAACATAGAACCTACG
GGCCGCCTCGCTATTGGTTGCAGGCCCCTCTCATTTTCATAG
Transcript >AgabiH97|002850
ATGAACTTCAAGTTCCTCGCCCTCATTGCCTTCGCTACCGCAGTCATTGCCGCTCCCGCTTCTGAAGATGTTCTG
GCCGACTTCAGCGACCCCCACCCCGGAGCTCCTGAAACTGCTGGCACTCGACTCAGCACTTCAGCAAGAGACGAT
CTTGTTCAAACTGAATCCTATCAAGCTCGCCCCAACTCGTATGATCCCCGCCAGGACCCCAGTCAAGATGCCATA
GCAGCACTGCTCGCCTTGGGGAATTATTCCGGTCTTACCTTCGATCCCGCTACCACTTCCCCCATGATTGGGTTG
GAATGTATTCCTTTCGACGAGCTCTTTGGTACCTGCTCCTCGACGCCCGTTTGTTGTAATAACATAGAACCTACG
GGCCGCCTCGCTATTGGTTGCAGGCCCCTCTCATTTTCATAG
Gene >AgabiH97|002850
ATGAACTTCAAGTTCCTCGCCCTCATTGCCTTCGCTACCGCAGTCATTGCCGCTCCCGCTTCTGAAGATGTTCTG
GCCGACTTCAGCGACCCCCACCCCGGAGCTCCTGAAACTGCTGGCACTCGACTCAGCACTTCAGCAAGAGACGAT
CTTGTTCAAACTGAATCCTATCAAGCTCGCCCCAACTCGTATGATCCCCGCCAGGACCGTCAGTGCAGAAGGGGC
TTCGCGCAATGTTGCAATCGGCTTCAACAAGCCAGTCAAGATGCCATAGCAGCACTGCTCGCCTTGGGGAATTAT
TCCGGTCTTACCTTCGATCCCGCTACCACTTCCCCCATGATTGGGTTGGAATGTATTCCTTTCGACGAGCTCTTT
GGTACCTGGTAACTATTGCTGCTATCCGATAGGTAATCATTCCGCTTACATTTCTCTTCAGCTCCTCGACGCCCG
TTTGTTGTAATAACATAGAACCTAGTAAGATTTTTGGCGCATATGTCGACGACTTCGTCGCTGATCATGATTTTC
CAGCGGGCCGCCTCGCTATTGGTTGCAGGCCCCTCTCATTTTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail