Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|002730
Gene name
Locationscaffold_1:699188..700379
Strand-
Gene length (bp)1191
Transcript length (bp)978
Coding sequence length (bp)978
Protein length (aa) 326

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10230 LIDHydrolase Lipid-droplet associated hydrolase 2.4E-48 50 300
PF12146 Hydrolase_4 Serine aminopeptidase, S33 5.0E-07 107 203

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BVA5|LDAH_MOUSE Lipid droplet-associated hydrolase OS=Mus musculus GN=Ldah PE=1 SV=1 49 315 4.0E-24
sp|Q5HZX7|LDAH_RAT Lipid droplet-associated hydrolase OS=Rattus norvegicus GN=Ldah PE=2 SV=1 51 315 5.0E-20
sp|Q5R7E8|LDAH_PONAB Lipid droplet-associated hydrolase OS=Pongo abelii GN=LDAH PE=2 SV=1 46 308 1.0E-19
sp|Q9H6V9|LDAH_HUMAN Lipid droplet-associated hydrolase OS=Homo sapiens GN=LDAH PE=1 SV=1 46 308 6.0E-19
sp|Q9W0H3|LDAH_DROME Lipid droplet-associated hydrolase OS=Drosophila melanogaster GN=CG9186 PE=2 SV=1 33 308 8.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BVA5|LDAH_MOUSE Lipid droplet-associated hydrolase OS=Mus musculus GN=Ldah PE=1 SV=1 49 315 4.0E-24
sp|Q5HZX7|LDAH_RAT Lipid droplet-associated hydrolase OS=Rattus norvegicus GN=Ldah PE=2 SV=1 51 315 5.0E-20
sp|Q5R7E8|LDAH_PONAB Lipid droplet-associated hydrolase OS=Pongo abelii GN=LDAH PE=2 SV=1 46 308 1.0E-19
sp|Q9H6V9|LDAH_HUMAN Lipid droplet-associated hydrolase OS=Homo sapiens GN=LDAH PE=1 SV=1 46 308 6.0E-19
sp|Q9W0H3|LDAH_DROME Lipid droplet-associated hydrolase OS=Drosophila melanogaster GN=CG9186 PE=2 SV=1 33 308 8.0E-17
sp|Q5F477|LDAH_CHICK Lipid droplet-associated hydrolase OS=Gallus gallus GN=LDAH PE=2 SV=2 32 315 5.0E-16
sp|Q06522|YP147_YEAST Uncharacterized protein YPR147C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPR147C PE=1 SV=1 51 305 3.0E-15
sp|Q54LL8|LDAH_DICDI Lipid droplet-associated hydrolase OS=Dictyostelium discoideum GN=DDB_G0286581 PE=3 SV=1 52 315 2.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0016298 lipase activity Yes
GO:0005811 lipid droplet Yes
GO:0019915 lipid storage Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0043228 non-membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0016787 hydrolase activity No
GO:0051235 maintenance of location No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|002730
MASLPSFLDPLPSRPSHGPYANAFFDHAYPLAPAHCLWWPPLKPGRRVETIVLFIPGNPGLLDFYTPFLTALQDK
DLTENLAILAHAHIDHTPGVYTRASPHSRHSLTSQVQSAIEAFDALSAEFPIARVMIIGHSVGAWVALQVLKERS
EDVAGVFLLFPTICHIAKTPNGRKLSTLFKPFPRRIISRLSVIGKYMPLPVLHRLVGLEWPINQLKVLLELIRSP
QSISAALLMGHEEMLQIRDLDVNLLQENRHRLWFYFADHDDWVGKQRHHILSNFKPDSGSLRITFGEPFIPHAFC
INHGEEVARQCHQWLLEMNINLSLS*
Coding >AgabiH97|002730
ATGGCCAGTCTCCCCTCGTTTCTCGACCCCCTGCCCTCGCGGCCGTCCCATGGGCCCTACGCCAACGCGTTCTTC
GACCACGCTTACCCTCTTGCCCCTGCCCACTGTCTCTGGTGGCCCCCTCTGAAACCTGGCCGGCGTGTGGAAACA
ATCGTCCTCTTCATCCCAGGAAACCCAGGGCTTCTTGATTTTTACACTCCATTCCTCACCGCACTGCAGGACAAG
GACTTGACCGAGAATCTTGCTATCCTCGCCCACGCTCACATCGACCATACACCTGGCGTATACACCCGCGCTTCA
CCACACTCCAGACATAGCTTGACCTCCCAGGTCCAGAGTGCGATAGAAGCATTCGATGCATTATCTGCAGAATTC
CCCATCGCCAGAGTCATGATCATCGGCCATAGTGTTGGCGCTTGGGTGGCGTTGCAGGTCTTGAAAGAACGCTCG
GAGGACGTCGCCGGTGTTTTCCTTCTCTTCCCTACTATCTGTCATATTGCCAAGACACCAAACGGAAGGAAGCTC
TCGACATTGTTCAAACCTTTTCCGAGGCGTATCATCTCTCGCTTGTCAGTCATTGGCAAATACATGCCGCTTCCT
GTCCTCCATAGACTTGTAGGCCTCGAGTGGCCGATAAATCAGCTCAAAGTTCTCCTTGAACTCATACGAAGTCCT
CAAAGTATCAGCGCGGCTTTGCTCATGGGTCACGAGGAAATGCTTCAAATACGTGACCTTGACGTCAACCTGCTG
CAAGAAAACCGTCATCGCCTGTGGTTCTACTTTGCTGACCACGATGACTGGGTCGGTAAGCAACGGCATCATATA
TTAAGTAACTTTAAACCAGACTCTGGCTCTTTGCGGATAACGTTCGGGGAACCTTTCATACCACATGCGTTTTGC
ATTAATCACGGGGAGGAGGTGGCCCGTCAGTGTCACCAATGGCTTTTGGAGATGAATATCAACCTGAGCTTATCA
TGA
Transcript >AgabiH97|002730
ATGGCCAGTCTCCCCTCGTTTCTCGACCCCCTGCCCTCGCGGCCGTCCCATGGGCCCTACGCCAACGCGTTCTTC
GACCACGCTTACCCTCTTGCCCCTGCCCACTGTCTCTGGTGGCCCCCTCTGAAACCTGGCCGGCGTGTGGAAACA
ATCGTCCTCTTCATCCCAGGAAACCCAGGGCTTCTTGATTTTTACACTCCATTCCTCACCGCACTGCAGGACAAG
GACTTGACCGAGAATCTTGCTATCCTCGCCCACGCTCACATCGACCATACACCTGGCGTATACACCCGCGCTTCA
CCACACTCCAGACATAGCTTGACCTCCCAGGTCCAGAGTGCGATAGAAGCATTCGATGCATTATCTGCAGAATTC
CCCATCGCCAGAGTCATGATCATCGGCCATAGTGTTGGCGCTTGGGTGGCGTTGCAGGTCTTGAAAGAACGCTCG
GAGGACGTCGCCGGTGTTTTCCTTCTCTTCCCTACTATCTGTCATATTGCCAAGACACCAAACGGAAGGAAGCTC
TCGACATTGTTCAAACCTTTTCCGAGGCGTATCATCTCTCGCTTGTCAGTCATTGGCAAATACATGCCGCTTCCT
GTCCTCCATAGACTTGTAGGCCTCGAGTGGCCGATAAATCAGCTCAAAGTTCTCCTTGAACTCATACGAAGTCCT
CAAAGTATCAGCGCGGCTTTGCTCATGGGTCACGAGGAAATGCTTCAAATACGTGACCTTGACGTCAACCTGCTG
CAAGAAAACCGTCATCGCCTGTGGTTCTACTTTGCTGACCACGATGACTGGGTCGGTAAGCAACGGCATCATATA
TTAAGTAACTTTAAACCAGACTCTGGCTCTTTGCGGATAACGTTCGGGGAACCTTTCATACCACATGCGTTTTGC
ATTAATCACGGGGAGGAGGTGGCCCGTCAGTGTCACCAATGGCTTTTGGAGATGAATATCAACCTGAGCTTATCA
TGA
Gene >AgabiH97|002730
ATGGCCAGTCTCCCCTCGTTTCTCGACCCCCTGCCCTCGCGGCCGTCCCATGGGCCCTACGCCAACGCGTTCTTC
GACCACGCTTACCCTCTTGCCCCTGCCCACTGTCTCTGGTGGCCCCCTCTGAAACCTGGCCGGCGTGTGGAAACA
ATCGTCCTCTTCATCCCAGGTTTCTCTCCCTTGTAACTCCTTTCCACCCCATTTTCTGACTTTCTTCCAGGAAAC
CCAGGGCTTCTTGATTTTTACACTCCATTCCTCACCGCACTGCAGGACAAGGACTTGACCGAGAATCTTGCTATC
CTCGCCCACGCTCACATCGACCATACACCTGGCGTATACACCCGCGCTTCACCACACTCCAGACATAGCTTGACC
TCCCAGGTCCAGAGTGCGATAGAAGCATTCGATGCATTATCTGCAGAATTCCCCATCGCCAGAGTCATGATCATC
GGCCATAGTGTTGGCGCTTGGGTGGCGTTGCAGGTCAGTTTCAGATGCCCCTTCCGTTTCGGTTGCTTCTTCACC
GACGTTTCAGGTCTTGAAAGAACGCTCGGAGGACGTCGCCGGTGTTTTCCTTCTCTTCCCTACTATCTGTCATAT
TGCCAAGACACCAAACGGAAGGAAGCTCTCGGTCGGTACAAGCTTTTTGCTTTTCCCCCTATGAATTCAGCTTCT
AATGACAACTTCAAGACATTGTTCAAACCTTTTCCGAGGCGTATCATCTCTCGCTTGTCAGTCATTGGCAAATAC
ATGCCGCTTCCTGTCCTCCATAGACTTGTAGGCCTCGAGTGGCCGATAAATCAGCTCAAAGTTCTCCTTGAACTC
ATACGAAGTCCTCAAAGTATCAGCGCGGCTTTGCTCATGGGTCACGAGGAAATGCTTCAAATACGTGACCTTGAC
GTCAACCTGCTGCAAGAAAACCGTCATCGCCTGTGGTTCTACTTTGCTGACCACGATGACTGGGTCGGTAAGCAA
CGGCATCATATATTAAGTAACTTTAAACCAGACTCTGGCTCTTTGCGGATAACGTTCGGGGAACCTTTCATACCA
CATGCGTTTTGCATTAGTGAGTGCTACTTTGTTGCAAAATCCTGGCTTTCTTGACGCGTTTGTATAGATCACGGG
GAGGAGGTGGCCCGTCAGTGTCACCAATGGCTTTTGGAGATGAATATCAACCTGAGCTTATCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail