Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|002670
Gene name
Locationscaffold_1:677553..678378
Strand-
Gene length (bp)825
Transcript length (bp)642
Coding sequence length (bp)642
Protein length (aa) 214

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03134 TB2_DP1_HVA22 TB2/DP1, HVA22 family 4.0E-28 19 97

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H6H4|REEP4_HUMAN Receptor expression-enhancing protein 4 OS=Homo sapiens GN=REEP4 PE=1 SV=1 1 115 7.0E-21
sp|Q4QQW1|REEP4_RAT Receptor expression-enhancing protein 4 OS=Rattus norvegicus GN=Reep4 PE=1 SV=1 1 115 9.0E-21
sp|Q5R598|REEP4_PONAB Receptor expression-enhancing protein 4 OS=Pongo abelii GN=REEP4 PE=2 SV=1 1 115 1.0E-20
sp|Q8K072|REEP4_MOUSE Receptor expression-enhancing protein 4 OS=Mus musculus GN=Reep4 PE=1 SV=1 1 115 2.0E-20
sp|Q3ZCI8|REEP4_BOVIN Receptor expression-enhancing protein 4 OS=Bos taurus GN=REEP4 PE=2 SV=1 1 115 4.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H6H4|REEP4_HUMAN Receptor expression-enhancing protein 4 OS=Homo sapiens GN=REEP4 PE=1 SV=1 1 115 7.0E-21
sp|Q4QQW1|REEP4_RAT Receptor expression-enhancing protein 4 OS=Rattus norvegicus GN=Reep4 PE=1 SV=1 1 115 9.0E-21
sp|Q5R598|REEP4_PONAB Receptor expression-enhancing protein 4 OS=Pongo abelii GN=REEP4 PE=2 SV=1 1 115 1.0E-20
sp|Q8K072|REEP4_MOUSE Receptor expression-enhancing protein 4 OS=Mus musculus GN=Reep4 PE=1 SV=1 1 115 2.0E-20
sp|Q3ZCI8|REEP4_BOVIN Receptor expression-enhancing protein 4 OS=Bos taurus GN=REEP4 PE=2 SV=1 1 115 4.0E-20
sp|Q9LR09|HA22G_ARATH Putative HVA22-like protein g OS=Arabidopsis thaliana GN=HVA22G PE=3 SV=2 14 113 2.0E-18
sp|Q8LEM6|HA22H_ARATH HVA22-like protein h OS=Arabidopsis thaliana GN=HVA22H PE=2 SV=2 1 132 5.0E-18
sp|Q5BL63|REEP4_XENTR Receptor expression-enhancing protein 4 OS=Xenopus tropicalis GN=reep4 PE=2 SV=1 1 141 7.0E-18
sp|Q7ZVX5|REEP3_DANRE Receptor expression-enhancing protein 3 OS=Danio rerio GN=reep3 PE=2 SV=1 1 145 8.0E-18
sp|Q4KMI4|REEP2_DANRE Receptor expression-enhancing protein 2 OS=Danio rerio GN=reep2 PE=2 SV=1 1 143 1.0E-17
sp|Q6AZM3|REEP4_XENLA Receptor expression-enhancing protein 4 OS=Xenopus laevis GN=reep4 PE=1 SV=1 1 141 1.0E-17
sp|Q6NLY8|HA22K_ARATH HVA22-like protein k OS=Arabidopsis thaliana GN=HVA22K PE=2 SV=1 18 134 3.0E-17
sp|Q6NUK4|REEP3_HUMAN Receptor expression-enhancing protein 3 OS=Homo sapiens GN=REEP3 PE=1 SV=1 1 153 3.0E-17
sp|Q99KK1|REEP3_MOUSE Receptor expression-enhancing protein 3 OS=Mus musculus GN=Reep3 PE=1 SV=1 1 196 6.0E-17
sp|Q8VCD6|REEP2_MOUSE Receptor expression-enhancing protein 2 OS=Mus musculus GN=Reep2 PE=1 SV=2 1 145 1.0E-16
sp|Q2KI30|REEP2_BOVIN Receptor expression-enhancing protein 2 OS=Bos taurus GN=REEP2 PE=2 SV=1 1 143 2.0E-16
sp|Q9BRK0|REEP2_HUMAN Receptor expression-enhancing protein 2 OS=Homo sapiens GN=REEP2 PE=1 SV=2 1 115 5.0E-16
sp|Q8GXE9|HA22J_ARATH HVA22-like protein j OS=Arabidopsis thaliana GN=HVA22J PE=2 SV=2 1 113 5.0E-16
sp|Q6P418|REP3A_XENLA Receptor expression-enhancing protein 3-A OS=Xenopus laevis GN=reep3-a PE=2 SV=1 1 145 7.0E-16
sp|Q8LE10|HA22I_ARATH HVA22-like protein i OS=Arabidopsis thaliana GN=HVA22I PE=2 SV=2 1 132 7.0E-16
sp|Q5HZP8|REP3B_XENLA Receptor expression-enhancing protein 3-B OS=Xenopus laevis GN=reep3-b PE=2 SV=1 1 115 3.0E-15
sp|Q9H902|REEP1_HUMAN Receptor expression-enhancing protein 1 OS=Homo sapiens GN=REEP1 PE=1 SV=1 1 145 4.0E-15
sp|Q8BGH4|REEP1_MOUSE Receptor expression-enhancing protein 1 OS=Mus musculus GN=Reep1 PE=1 SV=1 1 145 4.0E-15
sp|Q29RM3|REEP5_BOVIN Receptor expression-enhancing protein 5 OS=Bos taurus GN=REEP5 PE=2 SV=1 5 106 1.0E-13
sp|Q00765|REEP5_HUMAN Receptor expression-enhancing protein 5 OS=Homo sapiens GN=REEP5 PE=1 SV=3 5 115 2.0E-13
sp|Q5RE33|REEP5_PONAB Receptor expression-enhancing protein 5 OS=Pongo abelii GN=REEP5 PE=2 SV=1 5 115 2.0E-13
sp|Q60870|REEP5_MOUSE Receptor expression-enhancing protein 5 OS=Mus musculus GN=Reep5 PE=1 SV=1 5 115 3.0E-13
sp|B2RZ37|REEP5_RAT Receptor expression-enhancing protein 5 OS=Rattus norvegicus GN=Reep5 PE=1 SV=1 5 115 7.0E-13
sp|Q66IF1|REEP6_DANRE Receptor expression-enhancing protein 6 OS=Danio rerio GN=reep6 PE=2 SV=1 9 112 3.0E-12
sp|Q32LG5|REEP6_BOVIN Receptor expression-enhancing protein 6 OS=Bos taurus GN=REEP6 PE=2 SV=1 9 112 4.0E-12
sp|Q5XI60|REEP6_RAT Receptor expression-enhancing protein 6 OS=Rattus norvegicus GN=Reep6 PE=2 SV=1 9 112 9.0E-12
sp|Q96HR9|REEP6_HUMAN Receptor expression-enhancing protein 6 OS=Homo sapiens GN=REEP6 PE=1 SV=1 7 106 2.0E-11
sp|Q9JM62|REEP6_MOUSE Receptor expression-enhancing protein 6 OS=Mus musculus GN=Reep6 PE=1 SV=1 7 112 5.0E-11
sp|Q75A56|YOP1_ASHGO Protein YOP1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YOP1 PE=3 SV=2 6 96 6.0E-11
sp|Q6CP93|YOP1_KLULA Protein YOP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YOP1 PE=3 SV=1 1 97 2.0E-10
sp|Q4P0H0|YOP1_USTMA Protein YOP1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=YOP1 PE=3 SV=1 16 103 3.0E-10
sp|Q12402|YOP1_YEAST Protein YOP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOP1 PE=1 SV=3 1 97 4.0E-10
sp|O14355|YB49_SCHPO Uncharacterized membrane protein C30D10.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC30D10.09c PE=3 SV=1 34 119 6.0E-10
sp|Q10010|YSV4_CAEEL Uncharacterized protein T19C3.4 OS=Caenorhabditis elegans GN=T19C3.4 PE=3 SV=1 6 107 7.0E-10
sp|Q6FMU3|YOP1_CANGA Protein YOP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YOP1 PE=3 SV=1 6 97 2.0E-09
sp|Q6BWH8|YOP1_DEBHA Protein YOP1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YOP1 PE=3 SV=1 1 109 4.0E-09
sp|Q9UU91|YOP1_SCHPO Protein yop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yop1 PE=1 SV=1 4 97 2.0E-08
sp|Q682H0|HA22F_ARATH HVA22-like protein f OS=Arabidopsis thaliana GN=HVA22F PE=2 SV=1 16 97 3.0E-08
sp|P0CN16|YOP1_CRYNJ Protein YOP1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=YOP1 PE=3 SV=1 3 96 4.0E-08
sp|P0CN17|YOP1_CRYNB Protein YOP1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=YOP1 PE=3 SV=1 3 96 4.0E-08
sp|Q07764|HVA22_HORVU Protein HVA22 OS=Hordeum vulgare GN=HVA22 PE=2 SV=1 5 95 2.0E-07
sp|Q51VY4|YOP1_MAGO7 Protein YOP1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=YOP1 PE=3 SV=2 16 96 4.0E-07
sp|Q871R7|YOP1_NEUCR Protein yop-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=yop-1 PE=3 SV=1 8 96 5.0E-07
sp|Q6CE07|YOP1_YARLI Protein YOP1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YOP1 PE=3 SV=2 1 97 1.0E-06
sp|Q5BB01|YOP1_EMENI Protein yop1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=yop1 PE=3 SV=1 16 96 3.0E-06
sp|Q4WTW3|YOP1_ASPFU Protein yop1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=yop1 PE=3 SV=1 16 96 3.0E-06
sp|Q9FED2|HA22E_ARATH HVA22-like protein e OS=Arabidopsis thaliana GN=HVA22E PE=2 SV=1 16 98 6.0E-06
sp|Q9S760|HA22D_ARATH HVA22-like protein d OS=Arabidopsis thaliana GN=HVA22D PE=2 SV=1 16 101 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 45 67 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|002670
MLMFLLSHLISAWFAFLLPSYATFKALAHPPDNQQELQRWGMYWSVVGVFLAVEYAAEWLISWLPFYWEAKTLFL
LFLALPQTQGSTYIYNNYLQPFFVQNESDFDAGIVQVQKNIVTFIQSRLAFFWEWLANIANKGQGVTSTNTTTNG
QAPPNSAVQTVLGLWKTYGNSALSVLGYSTSTQSSAGNSNNGVPSPSASSAGAPSFPEPQHVH*
Coding >AgabiH97|002670
ATGCTGATGTTTTTGCTCTCCCATCTTATCTCCGCCTGGTTTGCCTTTCTTCTTCCCAGCTATGCCACCTTCAAG
GCCCTCGCCCACCCTCCCGACAACCAACAGGAGCTCCAGAGATGGGGCATGTACTGGTCCGTCGTCGGCGTTTTC
CTCGCTGTAGAGTATGCTGCAGAATGGCTCATCAGTTGGTTGCCATTCTACTGGGAAGCCAAGACTCTTTTCCTC
CTGTTCCTTGCCCTTCCGCAAACACAGGGCTCGACCTATATCTACAACAATTATTTGCAACCCTTCTTCGTCCAA
AACGAATCAGACTTCGACGCTGGTATCGTCCAAGTTCAGAAAAACATTGTTACCTTTATACAATCTCGCCTCGCT
TTCTTCTGGGAATGGCTCGCCAACATTGCCAATAAAGGTCAAGGTGTTACGTCCACCAACACTACTACCAATGGC
CAAGCCCCACCCAACAGCGCCGTCCAAACCGTGTTAGGTCTGTGGAAAACTTACGGTAACTCCGCACTGAGCGTC
CTGGGGTATTCTACCTCCACGCAGTCGTCAGCTGGTAATAGTAACAATGGTGTCCCAAGTCCATCTGCCTCTTCC
GCCGGGGCTCCATCGTTCCCGGAGCCTCAACACGTTCATTGA
Transcript >AgabiH97|002670
ATGCTGATGTTTTTGCTCTCCCATCTTATCTCCGCCTGGTTTGCCTTTCTTCTTCCCAGCTATGCCACCTTCAAG
GCCCTCGCCCACCCTCCCGACAACCAACAGGAGCTCCAGAGATGGGGCATGTACTGGTCCGTCGTCGGCGTTTTC
CTCGCTGTAGAGTATGCTGCAGAATGGCTCATCAGTTGGTTGCCATTCTACTGGGAAGCCAAGACTCTTTTCCTC
CTGTTCCTTGCCCTTCCGCAAACACAGGGCTCGACCTATATCTACAACAATTATTTGCAACCCTTCTTCGTCCAA
AACGAATCAGACTTCGACGCTGGTATCGTCCAAGTTCAGAAAAACATTGTTACCTTTATACAATCTCGCCTCGCT
TTCTTCTGGGAATGGCTCGCCAACATTGCCAATAAAGGTCAAGGTGTTACGTCCACCAACACTACTACCAATGGC
CAAGCCCCACCCAACAGCGCCGTCCAAACCGTGTTAGGTCTGTGGAAAACTTACGGTAACTCCGCACTGAGCGTC
CTGGGGTATTCTACCTCCACGCAGTCGTCAGCTGGTAATAGTAACAATGGTGTCCCAAGTCCATCTGCCTCTTCC
GCCGGGGCTCCATCGTTCCCGGAGCCTCAACACGTTCATTGA
Gene >AgabiH97|002670
ATGCTGATGTTTTTGCTCTCCCATCTTATCTCGTACGTCCCCCCAAGTCCGTCTCAGGTGTTCGAAGTGCTCATT
GTTCTCTCAGCGCCTGGTTTGCCTTTCTTCTTCCCAGCTATGCCACCTTCAAGGCCCTCGCCCACCCTCCCGACA
ACCAACAGGAGCTCCAGAGATGGGGCATGTACTGGTCCGTCGTCGGCGTTTTCCTCGCTGTAGAGTATGCTGCAG
AATGGCTCATCAGTTGGTAAGCACTAAACGACCAGGTGCCCTGACTTGATTGCTTAGTTAGACCATCCCTTGCCC
TTAGGTTGCCATTCTACTGGGAAGCCAAGACTCTTTTCCTCCTGTTCCTTGCCCTTCCGCAAACACAGGCAAGTC
ATATTCGTTGTATCGTTGTCAGGTCAGTCCGCTTATCGCACGACTCATTGTTATCTCTAGGGCTCGACCTATATC
TACAACAATTATTTGCAACCCTTCTTCGTCCAAAACGAATCAGACTTCGACGCTGGTATCGTCCAAGTTCAGAAA
AACATTGTTACCTTTATACAATCTCGCCTCGCTTTCTTCTGGGAATGGCTCGCCAACATTGCCAATAAAGGTCAA
GGTGTTACGTCCACCAACACTACTACCAATGGCCAAGCCCCACCCAACAGCGCCGTCCAAACCGTGTTAGGTCTG
TGGAAAACTTACGGTAACTCCGCACTGAGCGTCCTGGGGTATTCTACCTCCACGCAGTCGTCAGCTGGTAATAGT
AACAATGGTGTCCCAAGTCCATCTGCCTCTTCCGCCGGGGCTCCATCGTTCCCGGAGCCTCAACACGTTCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail