Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|002630
Gene name
Locationscaffold_1:667990..669037
Strand-
Gene length (bp)1047
Transcript length (bp)876
Coding sequence length (bp)876
Protein length (aa) 292

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 9.5E-10 102 183

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 1 289 5.0E-14
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 2 178 2.0E-12
sp|P25608|YCZ2_YEAST Uncharacterized protein YCR102C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR102C PE=3 SV=1 44 172 2.0E-11
sp|P54007|YL460_YEAST Uncharacterized protein YLR460C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR460C PE=1 SV=1 44 214 9.0E-11
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 3 182 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 1 289 5.0E-14
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 2 178 2.0E-12
sp|P25608|YCZ2_YEAST Uncharacterized protein YCR102C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR102C PE=3 SV=1 44 172 2.0E-11
sp|P54007|YL460_YEAST Uncharacterized protein YLR460C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR460C PE=1 SV=1 44 214 9.0E-11
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 3 182 2.0E-10
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 3 182 4.0E-10
sp|P53912|YNN4_YEAST Uncharacterized protein YNL134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL134C PE=1 SV=1 44 173 4.0E-10
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1 180 7.0E-09
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 3 178 1.0E-08
sp|Q9P7F4|YKK1_SCHPO Zinc-type alcohol dehydrogenase-like protein C2E1P3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.01 PE=3 SV=1 39 289 3.0E-08
sp|Q5AUY5|CIPB_EMENI Zinc-binding alcohol dehydrogenase domain-containing protein cipB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cipB PE=1 SV=1 1 189 1.0E-07
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 9 180 5.0E-06
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 9 180 5.0E-06
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 5 173 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|002630
MKVGSNIKDLKPTDRVTTFSYGPSRYKGIQQYAVQPRSIPGNLSFDAAATIPDNFACAFYILFNQLSLPMPLSLP
TLETPPLANSPILIYGAGSTAGQYMTRLLYLARYKNIIATASAKHHEYLRSLGATHVFDYRSSTLIEDINNVVGG
SNKLTMVVDCISATTTMNNIAKVLKPTGTVALLMPVKKGTTLNVDEESDLITTLPLPDQLNPFGEKANVIGVRTF
FYQEDTVLKERLLPAILPELLEKGLIEAPRYRIMDQGSLQQRAEQALELLRTNQLSGEKVIVKVSD*
Coding >AgabiH97|002630
ATGAAAGTTGGAAGCAATATCAAAGATCTGAAACCCACTGATCGGGTTACGACGTTCTCCTATGGACCCTCTCGC
TATAAGGGGATCCAGCAATATGCAGTTCAGCCTAGGAGTATCCCTGGCAATTTGTCCTTCGATGCTGCCGCGACG
ATTCCGGACAATTTCGCCTGCGCATTCTATATATTGTTCAATCAACTCTCCCTCCCTATGCCACTGAGTCTCCCT
ACCTTGGAGACCCCCCCTCTCGCCAACTCTCCAATCTTGATCTACGGTGCCGGATCGACCGCTGGGCAGTATATG
ACTCGCCTCCTTTACCTTGCTCGCTATAAAAACATCATTGCCACGGCTTCCGCAAAACATCACGAATACCTCCGT
AGTCTTGGGGCAACACATGTATTCGACTACCGCAGTTCAACTCTCATCGAAGACATCAATAACGTAGTCGGAGGG
TCGAATAAACTGACCATGGTCGTTGATTGTATTTCCGCCACGACTACCATGAACAACATTGCAAAAGTCTTGAAA
CCAACGGGGACTGTGGCACTACTGATGCCCGTCAAAAAAGGGACGACGTTGAATGTAGACGAGGAGAGTGATCTG
ATCACGACTTTGCCGCTACCAGACCAGTTGAATCCGTTCGGAGAAAAAGCCAATGTCATTGGCGTTAGGACGTTT
TTTTACCAAGAGGATACGGTATTGAAAGAGAGGCTACTCCCAGCCATTCTCCCAGAACTGCTGGAAAAGGGATTA
ATCGAGGCCCCGCGTTATCGTATTATGGACCAAGGAAGTCTTCAACAGAGAGCAGAGCAGGCGTTGGAGTTGCTC
AGAACGAACCAACTGAGTGGGGAGAAAGTTATTGTTAAAGTTTCGGATTGA
Transcript >AgabiH97|002630
ATGAAAGTTGGAAGCAATATCAAAGATCTGAAACCCACTGATCGGGTTACGACGTTCTCCTATGGACCCTCTCGC
TATAAGGGGATCCAGCAATATGCAGTTCAGCCTAGGAGTATCCCTGGCAATTTGTCCTTCGATGCTGCCGCGACG
ATTCCGGACAATTTCGCCTGCGCATTCTATATATTGTTCAATCAACTCTCCCTCCCTATGCCACTGAGTCTCCCT
ACCTTGGAGACCCCCCCTCTCGCCAACTCTCCAATCTTGATCTACGGTGCCGGATCGACCGCTGGGCAGTATATG
ACTCGCCTCCTTTACCTTGCTCGCTATAAAAACATCATTGCCACGGCTTCCGCAAAACATCACGAATACCTCCGT
AGTCTTGGGGCAACACATGTATTCGACTACCGCAGTTCAACTCTCATCGAAGACATCAATAACGTAGTCGGAGGG
TCGAATAAACTGACCATGGTCGTTGATTGTATTTCCGCCACGACTACCATGAACAACATTGCAAAAGTCTTGAAA
CCAACGGGGACTGTGGCACTACTGATGCCCGTCAAAAAAGGGACGACGTTGAATGTAGACGAGGAGAGTGATCTG
ATCACGACTTTGCCGCTACCAGACCAGTTGAATCCGTTCGGAGAAAAAGCCAATGTCATTGGCGTTAGGACGTTT
TTTTACCAAGAGGATACGGTATTGAAAGAGAGGCTACTCCCAGCCATTCTCCCAGAACTGCTGGAAAAGGGATTA
ATCGAGGCCCCGCGTTATCGTATTATGGACCAAGGAAGTCTTCAACAGAGAGCAGAGCAGGCGTTGGAGTTGCTC
AGAACGAACCAACTGAGTGGGGAGAAAGTTATTGTTAAAGTTTCGGATTGA
Gene >AgabiH97|002630
ATGAAAGTTGGAAGCAATATCAAAGATCTGAAACCCACTGATCGGGTATGCTTATCTTGTACATAAGAGGTTTGT
GAGTACTCAGCGCTTTCGGCATAGGTTACGACGTTCTCCTATGGACCCTCTCGCTATAAGGGGATCCAGCAATAT
GCAGTTCAGCCTAGGAGTGTATGCGCCAAGGCTTGTCGAGTCTTCACATTATTTGTGTCCCGACTGACGTGTTTT
CAAAGATCCCTGGCAATTTGTCCTTCGATGCTGCCGCGACGATTCCGGACAATTTCGCCTGCGCATTCTATATAT
TGTTCAATCAACTCTCCCTCCCTATGCCACTGAGTCTCCCTACCTTGGAGACCCCCCCTCTCGCCAACTCTCCAA
TCTTGATCTACGGTGCCGGATCGACCGCTGGGCAGTATATGACTCGCCTCCTTTACCTTGCTCGCTATAAAAACA
TCATTGCCACGGCTTCCGCAAAACATCACGAATACCTCCGTAGTCTTGGGGCAACACATGTATTCGACTACCGCA
GTTCAACTCTCATCGAAGACATCAATAACGTAGTCGGAGGGTCGAATAAACTGACCATGGTCGTTGATTGTATTT
CCGCCACGACTACCATGAACAACATTGCAAAAGTCTTGAAACCAACGGGGACTGTGGCACTACTGATGCCCGTCA
AAAAAGGGACGACGTTGAATGTAGACGAGGAGAGTGATCTGATCACGACTTTGCCGCTACCAGACCAGTTGAATC
CGTTCGGAGAAAAAGCCAATGTCATTGGCGTTAGGACGTTTTTTTACCAAGAGGTGCGTTACAGACGTCCAAGAC
AGAAACGTAAAATTTCCTAAATTTTGATTGTAGGATACGGTATTGAAAGAGAGGCTACTCCCAGCCATTCTCCCA
GAACTGCTGGAAAAGGGATTAATCGAGGCCCCGCGTTATCGTATTATGGACCAAGGAAGTCTTCAACAGAGAGCA
GAGCAGGCGTTGGAGTTGCTCAGAACGAACCAACTGAGTGGGGAGAAAGTTATTGTTAAAGTTTCGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail