Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|002580
Gene name
Locationscaffold_1:659364..660610
Strand+
Gene length (bp)1246
Transcript length (bp)1089
Coding sequence length (bp)1089
Protein length (aa) 363

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 5.6E-06 28 94

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AUY5|CIPB_EMENI Zinc-binding alcohol dehydrogenase domain-containing protein cipB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cipB PE=1 SV=1 19 262 1.0E-20
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 28 361 4.0E-20
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 26 234 1.0E-16
sp|P25608|YCZ2_YEAST Uncharacterized protein YCR102C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR102C PE=3 SV=1 59 242 1.0E-14
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 24 254 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5AUY5|CIPB_EMENI Zinc-binding alcohol dehydrogenase domain-containing protein cipB OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cipB PE=1 SV=1 19 262 1.0E-20
sp|Q9Y7D0|LOVC_ASPTE Enoyl reductase LovC OS=Aspergillus terreus GN=lovC PE=1 SV=1 28 361 4.0E-20
sp|P54006|TOXD_COCCA Protein TOXD OS=Cochliobolus carbonum GN=TOXD PE=3 SV=1 26 234 1.0E-16
sp|P25608|YCZ2_YEAST Uncharacterized protein YCR102C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR102C PE=3 SV=1 59 242 1.0E-14
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 24 254 2.0E-14
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 24 254 3.0E-14
sp|P54007|YL460_YEAST Uncharacterized protein YLR460C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR460C PE=1 SV=1 59 239 3.0E-13
sp|Q9SV68|QORH_ARATH Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 15 209 5.0E-13
sp|P53912|YNN4_YEAST Uncharacterized protein YNL134C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL134C PE=1 SV=1 5 334 3.0E-12
sp|Q6GEP3|ZDH1_STAAR Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 25 265 7.0E-11
sp|P0DN30|RTAI1_ARTBC Probable zinc-binding oxidoreductase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02327-2 PE=3 SV=1 21 235 1.0E-10
sp|Q6G7C8|ZDH1_STAAS Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 25 265 3.0E-10
sp|Q5HE19|ZDH1_STAAC Zinc-type alcohol dehydrogenase-like protein SACOL2177 OS=Staphylococcus aureus (strain COL) GN=SACOL2177 PE=3 SV=1 25 265 3.0E-10
sp|P63475|ZDH1_STAAM Zinc-type alcohol dehydrogenase-like protein SAV2186 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2186 PE=3 SV=1 25 265 3.0E-10
sp|P99173|ZDH1_STAAN Zinc-type alcohol dehydrogenase-like protein SA1988 OS=Staphylococcus aureus (strain N315) GN=SA1988 PE=1 SV=1 25 265 3.0E-10
sp|Q8NVD1|ZDH1_STAAW Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 25 265 3.0E-10
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 14 254 7.0E-10
sp|Q9P7F4|YKK1_SCHPO Zinc-type alcohol dehydrogenase-like protein C2E1P3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.01 PE=3 SV=1 84 219 1.0E-09
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 25 265 3.0E-09
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 46 252 4.0E-09
sp|Q8CRJ7|ZDH1_STAES Zinc-type alcohol dehydrogenase-like protein SE_1777 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1777 PE=3 SV=1 25 274 7.0E-09
sp|Q5HM44|ZDH1_STAEQ Zinc-type alcohol dehydrogenase-like protein SERP1785 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1785 PE=3 SV=1 25 274 8.0E-09
sp|Q5LS56|ACUI_RUEPO Acrylyl-CoA reductase AcuI OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=acuI PE=2 SV=1 29 237 9.0E-09
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 46 252 4.0E-08
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 25 320 4.0E-08
sp|Q9ZUC1|QORL_ARATH Quinone oxidoreductase-like protein At1g23740, chloroplastic OS=Arabidopsis thaliana GN=At1g23740 PE=2 SV=2 24 242 4.0E-08
sp|Q8H0M1|QORH_SPIOL Quinone-oxidoreductase homolog, chloroplastic OS=Spinacia oleracea GN=QOR PE=1 SV=1 15 209 7.0E-08
sp|P26325|ADH1_GADMC Alcohol dehydrogenase 1 OS=Gadus morhua subsp. callarias PE=1 SV=1 14 169 1.0E-07
sp|P0DMQ6|DHSO_CHICK Sorbitol dehydrogenase OS=Gallus gallus GN=SORD PE=1 SV=1 6 123 2.0E-07
sp|Q0VC50|RT4I1_BOVIN Reticulon-4-interacting protein 1, mitochondrial OS=Bos taurus GN=RTN4IP1 PE=2 SV=1 54 219 1.0E-06
sp|Q17335|ADHX_CAEEL Alcohol dehydrogenase class-3 OS=Caenorhabditis elegans GN=H24K24.3 PE=2 SV=1 1 155 1.0E-06
sp|Q00796|DHSO_HUMAN Sorbitol dehydrogenase OS=Homo sapiens GN=SORD PE=1 SV=4 6 132 2.0E-06
sp|Q8KQL2|ARPD_ENTAV D-arabitol-phosphate dehydrogenase OS=Enterococcus avium PE=1 SV=1 18 237 2.0E-06
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 57 251 2.0E-06
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 25 323 2.0E-06
sp|Q54II4|RT4I1_DICDI Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Dictyostelium discoideum GN=rtn4ip1 PE=3 SV=1 19 236 3.0E-06
sp|Q8LCU7|MECR_ARATH Probable trans-2-enoyl-CoA reductase, mitochondrial OS=Arabidopsis thaliana GN=At3g45770 PE=2 SV=1 14 235 4.0E-06
sp|P14941|ADH_THEBR NADP-dependent isopropanol dehydrogenase OS=Thermoanaerobacter brockii GN=adh PE=1 SV=1 1 132 4.0E-06
sp|Q4R639|DHSO_MACFA Sorbitol dehydrogenase OS=Macaca fascicularis GN=SORD PE=2 SV=3 21 123 6.0E-06
sp|Q59545|XYLD_MORMO D-xylulose reductase OS=Morganella morganii PE=1 SV=1 27 258 6.0E-06
sp|Q5R5F3|DHSO_PONAB Sorbitol dehydrogenase OS=Pongo abelii GN=SORD PE=2 SV=1 6 123 6.0E-06
sp|P77280|YDJJ_ECOLI Uncharacterized zinc-type alcohol dehydrogenase-like protein YdjJ OS=Escherichia coli (strain K12) GN=ydjJ PE=3 SV=1 13 166 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|002580
MSAHAAIAVTSKGVIETIEVPTEEPQDDEISVKVEYTAVIPPEVYMVDRGMFIESYPYILGFTTAGTVMKVGNNV
ENFKPNDRVTTYAYGPSHNKGMQQYVNQSSSVCAKIPDSLSLEAAATIPDNFVCAFYTLFNQLSLPMPSSFPASV
DPPLADTPILIYGAGATAGQYMIRLLHLARYKNIIVTASTMHHEYLRSLGATHAFDYRSSTLIEDLNRAVGGPNK
LSVAVDCISAINTMVNIKDVLSPTGTVALLMPVKEGISLNVDEGKNMILDLPLPAKLNPFEKETNIIGVRTFFYQ
ADPVLKEKLMPVILPDLLEKGLIGATPYRVLDQGNLQQRAEQALGLHRTNQVHGEKIIVKIH*
Coding >AgabiH97|002580
ATGTCTGCGCACGCTGCAATTGCCGTGACTTCCAAGGGCGTCATTGAAACTATCGAAGTGCCCACGGAAGAACCC
CAAGATGACGAGATTTCGGTAAAAGTCGAATACACGGCAGTTATTCCCCCTGAAGTGTACATGGTGGACAGAGGG
ATGTTCATCGAATCATATCCATATATTTTGGGGTTTACCACCGCTGGCACGGTGATGAAAGTCGGAAATAATGTC
GAGAATTTCAAGCCCAATGATCGGGTGACCACTTATGCGTATGGGCCCTCTCACAATAAAGGAATGCAGCAATAT
GTGAATCAAAGTAGTAGCGTTTGTGCAAAGATACCAGACAGTCTTTCCCTTGAAGCGGCTGCGACAATTCCAGAC
AATTTTGTCTGTGCGTTCTACACTCTTTTCAATCAACTCTCCCTTCCCATGCCTTCCAGTTTCCCTGCCTCAGTA
GACCCTCCTCTGGCAGACACCCCGATTCTGATTTATGGTGCCGGCGCGACCGCAGGTCAATATATGATTCGTCTC
CTTCACCTCGCTCGCTATAAAAATATCATTGTCACCGCTTCTACGATGCACCATGAATATCTTCGCTCCCTTGGA
GCAACTCATGCATTCGACTATCGAAGTTCTACTCTCATTGAAGATCTCAACAGAGCTGTTGGAGGTCCCAATAAA
TTGTCCGTGGCTGTTGATTGCATTTCTGCTATCAATACTATGGTCAACATCAAAGACGTGTTGAGTCCTACCGGA
ACAGTGGCACTACTGATGCCCGTGAAAGAGGGTATTTCATTGAATGTAGACGAGGGGAAAAATATGATTTTGGAT
TTGCCGCTGCCTGCTAAGTTGAATCCATTCGAAAAGGAAACCAACATCATTGGAGTTAGGACATTCTTCTATCAA
GCGGATCCTGTATTGAAAGAGAAATTGATGCCTGTCATTCTCCCAGATCTACTAGAGAAAGGATTGATCGGAGCG
ACGCCCTACCGTGTACTGGACCAGGGCAATCTCCAGCAGAGGGCAGAGCAGGCACTGGGACTGCATAGGACCAAC
CAAGTCCATGGAGAGAAGATCATTGTGAAGATTCACTGA
Transcript >AgabiH97|002580
ATGTCTGCGCACGCTGCAATTGCCGTGACTTCCAAGGGCGTCATTGAAACTATCGAAGTGCCCACGGAAGAACCC
CAAGATGACGAGATTTCGGTAAAAGTCGAATACACGGCAGTTATTCCCCCTGAAGTGTACATGGTGGACAGAGGG
ATGTTCATCGAATCATATCCATATATTTTGGGGTTTACCACCGCTGGCACGGTGATGAAAGTCGGAAATAATGTC
GAGAATTTCAAGCCCAATGATCGGGTGACCACTTATGCGTATGGGCCCTCTCACAATAAAGGAATGCAGCAATAT
GTGAATCAAAGTAGTAGCGTTTGTGCAAAGATACCAGACAGTCTTTCCCTTGAAGCGGCTGCGACAATTCCAGAC
AATTTTGTCTGTGCGTTCTACACTCTTTTCAATCAACTCTCCCTTCCCATGCCTTCCAGTTTCCCTGCCTCAGTA
GACCCTCCTCTGGCAGACACCCCGATTCTGATTTATGGTGCCGGCGCGACCGCAGGTCAATATATGATTCGTCTC
CTTCACCTCGCTCGCTATAAAAATATCATTGTCACCGCTTCTACGATGCACCATGAATATCTTCGCTCCCTTGGA
GCAACTCATGCATTCGACTATCGAAGTTCTACTCTCATTGAAGATCTCAACAGAGCTGTTGGAGGTCCCAATAAA
TTGTCCGTGGCTGTTGATTGCATTTCTGCTATCAATACTATGGTCAACATCAAAGACGTGTTGAGTCCTACCGGA
ACAGTGGCACTACTGATGCCCGTGAAAGAGGGTATTTCATTGAATGTAGACGAGGGGAAAAATATGATTTTGGAT
TTGCCGCTGCCTGCTAAGTTGAATCCATTCGAAAAGGAAACCAACATCATTGGAGTTAGGACATTCTTCTATCAA
GCGGATCCTGTATTGAAAGAGAAATTGATGCCTGTCATTCTCCCAGATCTACTAGAGAAAGGATTGATCGGAGCG
ACGCCCTACCGTGTACTGGACCAGGGCAATCTCCAGCAGAGGGCAGAGCAGGCACTGGGACTGCATAGGACCAAC
CAAGTCCATGGAGAGAAGATCATTGTGAAGATTCACTGA
Gene >AgabiH97|002580
ATGTCTGCGCACGCTGCAATTGCCGTGACTTCCAAGGGCGTCATTGAAACTATCGAAGTGCCCACGGAAGAACCC
CAAGATGACGAGATTTCGGTAAAAGTCGAATACACGGCAGTTATTCCCCCTGAAGTGTACATGGTGGACAGAGGG
ATGTTCATCGAATCATATCCATATATTTTGGGGTTTACCACCGCTGGCACGGTGATGAAAGTCGGAAATAATGTC
GAGAATTTCAAGCCCAATGATCGGGTACGCTCACGGTCTAATGAAATCCAGGTGTTTGTTTGACTTGGTTACAGG
TGACCACTTATGCGTATGGGCCCTCTCACAATAAAGGAATGCAGCAATATGTGAATCAAAGTAGTAGCGTTTGTG
CAAAGGTAAGGTACATGCAAAAATATCTGATTCATATGGAGACCAAGCCAGTTTTGTAGATACCAGACAGTCTTT
CCCTTGAAGCGGCTGCGACAATTCCAGACAATTTTGTCTGTGCGTTCTACACTCTTTTCAATCAACTCTCCCTTC
CCATGCCTTCCAGTTTCCCTGCCTCAGTAGACCCTCCTCTGGCAGACACCCCGATTCTGATTTATGGTGCCGGCG
CGACCGCAGGTCAATATATGATTCGTCTCCTTCACCTCGCTCGCTATAAAAATATCATTGTCACCGCTTCTACGA
TGCACCATGAATATCTTCGCTCCCTTGGAGCAACTCATGCATTCGACTATCGAAGTTCTACTCTCATTGAAGATC
TCAACAGAGCTGTTGGAGGTCCCAATAAATTGTCCGTGGCTGTTGATTGCATTTCTGCTATCAATACTATGGTCA
ACATCAAAGACGTGTTGAGTCCTACCGGAACAGTGGCACTACTGATGCCCGTGAAAGAGGGTATTTCATTGAATG
TAGACGAGGGGAAAAATATGATTTTGGATTTGCCGCTGCCTGCTAAGTTGAATCCATTCGAAAAGGAAACCAACA
TCATTGGAGTTAGGACATTCTTCTATCAAGCGGTGCGTCGCGAAACGCTGAACTTTTCACATTGATTTTCAATAC
AGAATTGTAGGATCCTGTATTGAAAGAGAAATTGATGCCTGTCATTCTCCCAGATCTACTAGAGAAAGGATTGAT
CGGAGCGACGCCCTACCGTGTACTGGACCAGGGCAATCTCCAGCAGAGGGCAGAGCAGGCACTGGGACTGCATAG
GACCAACCAAGTCCATGGAGAGAAGATCATTGTGAAGATTCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail