Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|002570
Gene name
Locationscaffold_1:656880..658885
Strand+
Gene length (bp)2005
Transcript length (bp)1632
Coding sequence length (bp)1632
Protein length (aa) 544

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00262 Calreticulin Calreticulin family 1.6E-154 38 405

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AVD4|CALX_ARTBC Calnexin homolog ARB_00147 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00147 PE=3 SV=1 25 499 2.0E-171
sp|Q6Q487|CALX_ASPFU Calnexin homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G12850 PE=2 SV=2 1 503 5.0E-162
sp|P35564|CALX_MOUSE Calnexin OS=Mus musculus GN=Canx PE=1 SV=1 38 442 1.0E-131
sp|P35565|CALX_RAT Calnexin OS=Rattus norvegicus GN=Canx PE=1 SV=1 38 430 4.0E-130
sp|P36581|CALX_SCHPO Calnexin homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cal1 PE=1 SV=1 8 539 1.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AVD4|CALX_ARTBC Calnexin homolog ARB_00147 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00147 PE=3 SV=1 25 499 2.0E-171
sp|Q6Q487|CALX_ASPFU Calnexin homolog OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G12850 PE=2 SV=2 1 503 5.0E-162
sp|P35564|CALX_MOUSE Calnexin OS=Mus musculus GN=Canx PE=1 SV=1 38 442 1.0E-131
sp|P35565|CALX_RAT Calnexin OS=Rattus norvegicus GN=Canx PE=1 SV=1 38 430 4.0E-130
sp|P36581|CALX_SCHPO Calnexin homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cal1 PE=1 SV=1 8 539 1.0E-129
sp|Q5R440|CALX_PONAB Calnexin OS=Pongo abelii GN=CANX PE=2 SV=2 38 424 2.0E-129
sp|P27824|CALX_HUMAN Calnexin OS=Homo sapiens GN=CANX PE=1 SV=2 38 424 6.0E-129
sp|P24643|CALX_CANLF Calnexin OS=Canis lupus familiaris GN=CANX PE=1 SV=3 38 424 4.0E-128
sp|Q3SYT6|CLGN_BOVIN Calmegin OS=Bos taurus GN=CLGN PE=2 SV=1 38 427 2.0E-117
sp|E2RA18|CLGN_CANLF Calmegin OS=Canis lupus familiaris GN=CLGN PE=1 SV=2 38 423 2.0E-116
sp|O14967|CLGN_HUMAN Calmegin OS=Homo sapiens GN=CLGN PE=1 SV=1 38 423 4.0E-114
sp|P52194|CLGN_MOUSE Calmegin OS=Mus musculus GN=Clgn PE=1 SV=2 38 423 4.0E-114
sp|P29402|CALX1_ARATH Calnexin homolog 1 OS=Arabidopsis thaliana GN=CNX1 PE=1 SV=1 38 536 8.0E-114
sp|A8XA40|CALX_CAEBR Calnexin OS=Caenorhabditis briggsae GN=cnx-1 PE=3 SV=3 50 433 2.0E-106
sp|Q38798|CALX2_ARATH Calnexin homolog 2 OS=Arabidopsis thaliana GN=At5g07340 PE=2 SV=2 27 533 3.0E-104
sp|P34652|CALX_CAEEL Calnexin OS=Caenorhabditis elegans GN=cnx-1 PE=1 SV=1 50 433 2.0E-101
sp|Q39817|CALX_SOYBN Calnexin homolog OS=Glycine max PE=2 SV=1 2 507 2.0E-98
sp|Q39994|CALX_HELTU Calnexin homolog OS=Helianthus tuberosus PE=2 SV=1 36 525 1.0E-95
sp|O82709|CALX_PEA Calnexin homolog OS=Pisum sativum PE=2 SV=1 2 406 4.0E-91
sp|Q9ZNY3|CALR_EUGGR Calreticulin OS=Euglena gracilis PE=2 SV=1 38 430 9.0E-55
sp|P27798|CALR_CAEEL Calreticulin OS=Caenorhabditis elegans GN=crt-1 PE=3 SV=1 21 421 1.0E-53
sp|Q9STD3|CALR_CHLRE Calreticulin OS=Chlamydomonas reinhardtii PE=2 SV=1 38 428 3.0E-53
sp|Q61KR9|CALR_CAEBR Calreticulin OS=Caenorhabditis briggsae GN=crt-1 PE=3 SV=1 21 421 4.0E-53
sp|P27797|CALR_HUMAN Calreticulin OS=Homo sapiens GN=CALR PE=1 SV=1 38 428 2.0E-52
sp|Q4VIT5|CALR_CHLAE Calreticulin OS=Chlorocebus aethiops GN=CALR PE=2 SV=1 38 428 3.0E-52
sp|Q2HWU3|CALR_MACFU Calreticulin OS=Macaca fuscata fuscata GN=CALR PE=2 SV=1 38 428 3.0E-52
sp|Q4R6K8|CALR_MACFA Calreticulin OS=Macaca fascicularis GN=CALR PE=2 SV=1 38 428 3.0E-52
sp|P15253|CALR_RABIT Calreticulin OS=Oryctolagus cuniculus GN=CALR PE=1 SV=1 38 428 9.0E-52
sp|P28491|CALR_PIG Calreticulin OS=Sus scrofa GN=CALR PE=1 SV=3 38 428 4.0E-51
sp|P29413|CALR_DROME Calreticulin OS=Drosophila melanogaster GN=Crc PE=1 SV=2 1 444 9.0E-51
sp|P18418|CALR_RAT Calreticulin OS=Rattus norvegicus GN=Calr PE=1 SV=1 38 428 2.0E-50
sp|Q8K3H7|CALR_CRIGR Calreticulin OS=Cricetulus griseus GN=CALR PE=1 SV=1 38 428 3.0E-50
sp|Q23858|CALR_DICDI Calreticulin OS=Dictyostelium discoideum GN=crtA PE=1 SV=3 38 428 5.0E-50
sp|Q7Z1E6|CALR_BOMMO Calreticulin OS=Bombyx mori GN=crt PE=1 SV=1 38 405 2.0E-49
sp|P11012|CALR_ONCVO Calreticulin OS=Onchocerca volvulus GN=crt-1 PE=2 SV=2 23 424 3.0E-49
sp|P52193|CALR_BOVIN Calreticulin OS=Bos taurus GN=CALR PE=1 SV=2 38 428 3.0E-49
sp|P93508|CALR_RICCO Calreticulin OS=Ricinus communis PE=2 SV=1 38 420 7.0E-49
sp|P27825|CALX_YEAST Calnexin homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNE1 PE=1 SV=1 38 423 1.0E-47
sp|Q38858|CALR2_ARATH Calreticulin-2 OS=Arabidopsis thaliana GN=CRT2 PE=1 SV=3 38 430 5.0E-47
sp|Q9SLY8|CALR_ORYSJ Calreticulin OS=Oryza sativa subsp. japonica GN=Os07g0246200 PE=1 SV=2 38 430 7.0E-47
sp|Q40401|CALR_NICPL Calreticulin OS=Nicotiana plumbaginifolia GN=CAL1 PE=2 SV=1 38 424 1.0E-46
sp|O04151|CALR1_ARATH Calreticulin-1 OS=Arabidopsis thaliana GN=CRT1 PE=1 SV=1 38 430 3.0E-46
sp|O81919|CALR_BETVU Calreticulin OS=Beta vulgaris PE=2 SV=1 35 430 4.0E-46
sp|Q9XF98|CALR_PRUAR Calreticulin OS=Prunus armeniaca PE=2 SV=1 35 430 2.0E-45
sp|P14211|CALR_MOUSE Calreticulin OS=Mus musculus GN=Calr PE=1 SV=1 38 443 1.0E-44
sp|Q9ZPP1|CALR_BERST Calreticulin OS=Berberis stolonifera PE=2 SV=1 38 430 2.0E-43
sp|Q9SP22|CALR_MAIZE Calreticulin OS=Zea mays GN=CRT PE=2 SV=1 38 430 6.0E-43
sp|O04153|CALR3_ARATH Calreticulin-3 OS=Arabidopsis thaliana GN=CRT3 PE=1 SV=2 23 444 8.0E-40
sp|Q06814|CALR_SCHMA Calreticulin OS=Schistosoma mansoni PE=2 SV=2 70 449 1.0E-39
sp|Q9D9Q6|CALR3_MOUSE Calreticulin-3 OS=Mus musculus GN=Calr3 PE=1 SV=2 38 448 8.0E-25
sp|Q96L12|CALR3_HUMAN Calreticulin-3 OS=Homo sapiens GN=CALR3 PE=1 SV=2 38 428 3.0E-24
sp|Q2TBR8|CALR3_BOVIN Calreticulin-3 OS=Bos taurus GN=CALR3 PE=2 SV=1 38 447 3.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0006457 protein folding Yes
GO:0005783 endoplasmic reticulum Yes
GO:0005509 calcium ion binding Yes
GO:0051082 unfolded protein binding Yes
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0043227 membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0009987 cellular process No
GO:0005515 protein binding No
GO:0043229 intracellular organelle No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0046872 metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 488 510 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|002570
MRSVAISVAVLATAGTLVSCESLKELPTFTPTEIKAPFLEQFTEDWADRWTASEATKKNNAGSETFSYVGKWKVE
EATKSIIKGDHGLVAKSPASHHAISAPFKKPIDFKQKPLVVQYEVNYQKGGSCGGGYIKLLEDGFQSSGQDFDDK
TPWVVMFGPDLTCPGTKVHFIVRHKSPMTEEIEEKHYTGHPRFLVEKYTNLHTLVLHPNNTFNIYLNGELDKTGN
LLEDMQPPVNPPTEIDDPSDSKPDDWVEDDRIIDIHATKPDDWDEDAPRRIPDDEAEKPEGWLDDELPHIPDPDA
TKPDEWDDEEDGDWVAPTMPNPKCDNAPGCGPWERPMKNNPNYKGRWSAPLIDNPDYKGPWAPRKIPNPNYFEDP
TPVKSLPKIGGVGIELWTMTEDILFDNLYIGHSLEHAKKLAAETFDIKKPLERLAASVIEKLEGKDDEDDDDEVS
FKDDPVSFIRNRVLSFVENVKEDPIEAFKTQPETGVALLVTLFTIFGMFSGFLGFGGASAKPVITQTAKKADTSE
KKSETTSDDKKDDLKKRK*
Coding >AgabiH97|002570
ATGCGAAGCGTAGCGATCTCTGTCGCAGTCCTTGCCACCGCTGGCACCTTGGTCAGCTGTGAATCTCTCAAGGAA
TTGCCCACTTTCACGCCCACTGAAATCAAGGCACCTTTCCTTGAACAGTTCACTGAGGACTGGGCAGACCGCTGG
ACAGCCTCAGAAGCAACTAAGAAGAACAATGCTGGTTCGGAAACATTCTCTTACGTCGGCAAGTGGAAAGTGGAG
GAAGCCACCAAATCCATCATCAAAGGTGATCATGGCCTCGTTGCCAAATCCCCGGCTTCCCACCATGCGATTTCC
GCTCCATTCAAGAAACCCATTGACTTCAAGCAGAAACCTCTAGTAGTGCAGTACGAAGTCAATTACCAGAAAGGT
GGTAGCTGCGGTGGTGGATACATCAAGTTGCTTGAAGACGGCTTCCAGAGCAGTGGTCAGGACTTTGATGATAAA
ACCCCTTGGGTCGTCATGTTTGGTCCCGATTTGACATGTCCTGGCACCAAGGTGCACTTTATTGTCCGTCACAAG
AGCCCAATGACAGAAGAAATTGAGGAGAAGCACTATACGGGACATCCTCGTTTCTTGGTTGAGAAGTACACCAAC
CTCCACACTCTTGTTCTGCACCCCAACAATACCTTCAACATCTACCTTAACGGCGAGCTAGATAAGACTGGAAAC
CTTCTCGAAGACATGCAACCCCCCGTCAACCCGCCCACGGAAATTGATGATCCCTCTGATAGTAAACCCGATGAC
TGGGTTGAGGATGACAGGATTATTGATATCCACGCTACCAAACCCGATGACTGGGACGAAGATGCTCCTCGTCGG
ATCCCAGACGATGAAGCCGAGAAGCCCGAGGGCTGGCTTGATGATGAGCTCCCACACATCCCTGACCCCGATGCC
ACCAAACCCGACGAATGGGACGATGAAGAAGATGGTGACTGGGTCGCTCCTACAATGCCTAATCCCAAGTGTGAC
AATGCTCCTGGTTGTGGTCCATGGGAGCGCCCCATGAAGAACAATCCCAACTACAAGGGAAGATGGAGCGCCCCC
TTGATTGACAACCCTGATTACAAGGGCCCTTGGGCTCCTCGTAAGATTCCCAACCCCAACTACTTCGAGGACCCC
ACTCCAGTTAAGAGTCTCCCCAAGATTGGTGGCGTTGGTATTGAGCTCTGGACTATGACTGAGGACATCCTCTTT
GACAACTTGTACATCGGTCACTCCCTGGAGCATGCCAAGAAGCTAGCTGCAGAGACCTTTGACATCAAGAAGCCC
CTTGAGAGGCTGGCCGCTAGTGTGATCGAGAAACTCGAGGGTAAAGATGACGAAGATGATGATGATGAGGTTTCC
TTCAAGGACGATCCCGTCAGTTTCATCCGCAACAGGGTTCTCAGCTTCGTCGAAAATGTTAAGGAGGACCCCATT
GAAGCCTTCAAGACCCAACCTGAAACCGGTGTCGCTCTCCTTGTTACTCTCTTCACTATCTTCGGTATGTTCAGT
GGATTCCTTGGCTTTGGTGGTGCTTCAGCGAAGCCCGTCATTACTCAGACCGCTAAGAAGGCTGACACATCGGAG
AAAAAGTCGGAGACCACAAGTGATGATAAAAAAGACGACCTCAAGAAGCGCAAGTGA
Transcript >AgabiH97|002570
ATGCGAAGCGTAGCGATCTCTGTCGCAGTCCTTGCCACCGCTGGCACCTTGGTCAGCTGTGAATCTCTCAAGGAA
TTGCCCACTTTCACGCCCACTGAAATCAAGGCACCTTTCCTTGAACAGTTCACTGAGGACTGGGCAGACCGCTGG
ACAGCCTCAGAAGCAACTAAGAAGAACAATGCTGGTTCGGAAACATTCTCTTACGTCGGCAAGTGGAAAGTGGAG
GAAGCCACCAAATCCATCATCAAAGGTGATCATGGCCTCGTTGCCAAATCCCCGGCTTCCCACCATGCGATTTCC
GCTCCATTCAAGAAACCCATTGACTTCAAGCAGAAACCTCTAGTAGTGCAGTACGAAGTCAATTACCAGAAAGGT
GGTAGCTGCGGTGGTGGATACATCAAGTTGCTTGAAGACGGCTTCCAGAGCAGTGGTCAGGACTTTGATGATAAA
ACCCCTTGGGTCGTCATGTTTGGTCCCGATTTGACATGTCCTGGCACCAAGGTGCACTTTATTGTCCGTCACAAG
AGCCCAATGACAGAAGAAATTGAGGAGAAGCACTATACGGGACATCCTCGTTTCTTGGTTGAGAAGTACACCAAC
CTCCACACTCTTGTTCTGCACCCCAACAATACCTTCAACATCTACCTTAACGGCGAGCTAGATAAGACTGGAAAC
CTTCTCGAAGACATGCAACCCCCCGTCAACCCGCCCACGGAAATTGATGATCCCTCTGATAGTAAACCCGATGAC
TGGGTTGAGGATGACAGGATTATTGATATCCACGCTACCAAACCCGATGACTGGGACGAAGATGCTCCTCGTCGG
ATCCCAGACGATGAAGCCGAGAAGCCCGAGGGCTGGCTTGATGATGAGCTCCCACACATCCCTGACCCCGATGCC
ACCAAACCCGACGAATGGGACGATGAAGAAGATGGTGACTGGGTCGCTCCTACAATGCCTAATCCCAAGTGTGAC
AATGCTCCTGGTTGTGGTCCATGGGAGCGCCCCATGAAGAACAATCCCAACTACAAGGGAAGATGGAGCGCCCCC
TTGATTGACAACCCTGATTACAAGGGCCCTTGGGCTCCTCGTAAGATTCCCAACCCCAACTACTTCGAGGACCCC
ACTCCAGTTAAGAGTCTCCCCAAGATTGGTGGCGTTGGTATTGAGCTCTGGACTATGACTGAGGACATCCTCTTT
GACAACTTGTACATCGGTCACTCCCTGGAGCATGCCAAGAAGCTAGCTGCAGAGACCTTTGACATCAAGAAGCCC
CTTGAGAGGCTGGCCGCTAGTGTGATCGAGAAACTCGAGGGTAAAGATGACGAAGATGATGATGATGAGGTTTCC
TTCAAGGACGATCCCGTCAGTTTCATCCGCAACAGGGTTCTCAGCTTCGTCGAAAATGTTAAGGAGGACCCCATT
GAAGCCTTCAAGACCCAACCTGAAACCGGTGTCGCTCTCCTTGTTACTCTCTTCACTATCTTCGGTATGTTCAGT
GGATTCCTTGGCTTTGGTGGTGCTTCAGCGAAGCCCGTCATTACTCAGACCGCTAAGAAGGCTGACACATCGGAG
AAAAAGTCGGAGACCACAAGTGATGATAAAAAAGACGACCTCAAGAAGCGCAAGTGA
Gene >AgabiH97|002570
ATGCGAAGCGTAGCGATCTCTGTCGCAGTCCTTGCCACCGCTGGCACCTTGGTCAGCTGTGAATCTCTCAAGGAA
TTGCCCACTTTCACGGTACATCCTTCATCAACGTCATCACATAGTATCCGAATTTAATTCACCCTCTCACATCTA
GCCCACTGAAATCAAGGCACCTTTCCTTGAACAGTTCACTGAGGACTGGGCAGACCGCTGGACAGCCTCAGAAGC
AACTAAGAAGAACAATGCTGGTTCGGAAACATTCTCTTACGTCGGCAAGTGGAAAGTGGAGGAAGCCACCAAATC
CATCATCAAAGGTGATCATGGCCTCGTTGCCAAATCCCCGGCTTCCCACCATGCGATTTCCGCTCCATTCAAGAA
ACCCATTGACTTCAAGCAGAAACCTCTAGTAGTGCAGTACGAAGTCAATTACCAGAAAGGTGGTAGCTGCGGTGG
TGGATACATCAAGTTGCTTGAAGACGGCTTCCAGAGCAGTGGTCAGGACTTTGATGATAAAACCCCTTGGGTCGT
CATGTTTGGTCCCGATTTGACATGTCCTGGCACCAAGGTATGCTAAATTGGTTGAGGTTGTGGACAGTTCTTCTA
AACGTCTTTTGATAAATAGGTGCACTTTATTGTCCGTCACAAGAGCCCAATGACAGAAGAAATTGAGGAGAAGCA
CTATACGGGACATCCTCGTTTCTTGGTTGAGAAGTACACCAACCTCCACACTCTTGTTCTGCAGTACGTATACTC
TCATAAAATATTTGGTACTTGAATTAATTTCTTGTTAAGCCCCAACAATACCTTCAACATCTACCTTAACGGCGA
GCTAGATAAGACTGGAAACCTTCTCGAAGACATGCAACCCCCCGTCAACCCGCCCACGGAAATTGATGATCCCTC
TGATAGTAAACCCGATGACTGGGTTGAGGATGACAGGATTATTGATATCCACGCTACCAAAGTAAGTAGAGGCTC
CCGCTTCTGGTGCTTAGTATTTACTTATTTCAATCTAGCCCGATGACTGGGACGAAGATGCTCCTCGTCGGATCC
CAGACGATGAAGCCGAGAAGCCCGAGGGCTGGCTTGATGATGAGCTCCCACACATCCCTGACCCCGATGCCACCA
AACCCGACGAATGGGACGATGAAGAAGATGGTGACTGGGTCGCTCCTACAATGCCTAATCCCAAGTGTGACAATG
CTCCTGGTTGTGGTCCATGGGAGCGGTACGTTGTTTGCAGCAAGTCACCTCTACATCATGCTGATACTATGATAG
CCCCATGAAGAACAATCCCAACTACAAGGGAAGATGGAGCGCCCCCTTGATTGACAACCCTGATTACAAGGGCCC
TTGGGCTCCTCGTAAGATTCCCAACCCCAACTACTTCGAGGACCCCACTCCAGTTAAGAGTCTCCCCAAGATTGT
ACGTAAAATGTTTTACCCCGCATTCCGTTTACTCATTCAATCCCAGGGTGGCGTTGGTATTGAGCTCTGGACTAT
GACTGAGGACATCCTCTTTGACAACTTGTACATCGGTCACTCCCTGGAGCATGCCAAGAAGCTAGCTGCAGAGAC
CTTTGACATCAAGAAGCCCCTTGAGAGGCTGGCCGCTAGTGTGATCGAGAAACTCGAGGGTAAAGATGACGAAGA
TGATGATGATGAGGTTTCCTTCAAGGACGATCCCGTCAGTTTCATCCGCAACAGGGTTCTCAGCTTCGTCGAAAA
TGTTAAGGAGGACCCCATTGAAGCCTTCAAGACCCAACCTGAAACCGGTGTCGCTCTCCTTGTTACTCTCTTCAC
TATCTTCGGTATGTTCAGTGGATTCCTTGGCTTTGGTGGTGCTTCAGCGAAGCCCGTCATTACTCAGGTATGTCT
TTTTGGTTGCATATTGTATCTATCAACTAAGTCTTCTCTCTTCCAGACCGCTAAGAAGGCTGACACATCGGAGAA
AAAGTCGGAGACCACAAGTGATGATAAAAAAGACGACCTCAAGAAGCGCAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail