Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|002530
Gene name
Locationscaffold_1:648007..649335
Strand-
Gene length (bp)1328
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13202 EF-hand_5 EF hand 2.4E-03 103 125

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74903|YCS3_SCHPO Uncharacterized calcium-binding protein C613.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC613.03 PE=3 SV=1 38 197 9.0E-19
sp|P39931|SS120_YEAST Protein SSP120 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSP120 PE=1 SV=1 38 159 4.0E-06

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|002530
MFTRPLASLSLLALAHYAAAHGGHGESGPKAGETMQQYAQRHMSSEHHIDSFDAPSFFQLHDLNRDGIWDRSEIE
AVYGVHHVYSQKKSKDDEEHQKKADTIVDAVLRILDSNRDGVVDLKELERRGVDALPTFDHMGAEGHHYDVESEF
FLHHEEEFHSTPETQTDDSYNHPEDIEHFGHHEGIEREEAEREAKFAGVSVEEILAAQRAAEEEAAKRTAAQQDI
NNQQNLNAVDPNAPPARSPVIRVTPPEKQDPSVKYAGEKPHGEEWGTGDQGYKSPRDASDKLRKNLPYKYKFRRN
WGDF*
Coding >AgabiH97|002530
ATGTTCACACGACCGCTGGCCAGCCTTTCTCTTCTCGCTCTTGCACACTATGCAGCCGCTCATGGCGGTCATGGA
GAAAGTGGTCCAAAAGCTGGTGAAACTATGCAGCAATACGCACAAAGACACATGTCTTCAGAACACCATATTGAC
TCCTTCGATGCACCAAGTTTCTTCCAGTTACATGACCTAAATCGGGATGGTATCTGGGACAGATCTGAAATTGAA
GCAGTATATGGCGTTCACCACGTTTATTCACAAAAAAAATCCAAAGATGACGAGGAACACCAAAAGAAAGCGGAT
ACAATTGTCGATGCAGTACTACGGATTCTCGACTCGAACCGTGACGGTGTGGTGGACTTGAAAGAACTGGAAAGG
CGCGGAGTTGACGCTCTACCGACTTTCGACCATATGGGAGCTGAGGGCCACCACTACGATGTGGAAAGTGAATTC
TTTCTTCACCATGAAGAGGAATTCCATTCAACACCCGAAACCCAAACTGACGATTCTTACAACCACCCAGAAGAC
ATCGAACACTTCGGCCATCATGAAGGTATAGAGCGCGAAGAGGCTGAGCGTGAAGCCAAATTTGCTGGCGTGTCC
GTCGAGGAGATTCTTGCCGCACAGAGAGCTGCCGAAGAAGAGGCAGCAAAGCGTACAGCAGCTCAACAAGACATT
AATAACCAACAAAATTTGAATGCAGTCGACCCCAATGCACCTCCTGCACGATCACCCGTAATTCGTGTCACTCCT
CCCGAGAAACAAGATCCCTCTGTTAAATATGCTGGCGAGAAACCACATGGAGAGGAGTGGGGTACTGGTGACCAA
GGGTACAAGAGCCCTCGCGATGCAAGCGATAAACTGAGGAAGAACTTGCCTTACAAGTACAAATTCCGTAGGAAT
TGGGGAGATTTCTGA
Transcript >AgabiH97|002530
ATGTTCACACGACCGCTGGCCAGCCTTTCTCTTCTCGCTCTTGCACACTATGCAGCCGCTCATGGCGGTCATGGA
GAAAGTGGTCCAAAAGCTGGTGAAACTATGCAGCAATACGCACAAAGACACATGTCTTCAGAACACCATATTGAC
TCCTTCGATGCACCAAGTTTCTTCCAGTTACATGACCTAAATCGGGATGGTATCTGGGACAGATCTGAAATTGAA
GCAGTATATGGCGTTCACCACGTTTATTCACAAAAAAAATCCAAAGATGACGAGGAACACCAAAAGAAAGCGGAT
ACAATTGTCGATGCAGTACTACGGATTCTCGACTCGAACCGTGACGGTGTGGTGGACTTGAAAGAACTGGAAAGG
CGCGGAGTTGACGCTCTACCGACTTTCGACCATATGGGAGCTGAGGGCCACCACTACGATGTGGAAAGTGAATTC
TTTCTTCACCATGAAGAGGAATTCCATTCAACACCCGAAACCCAAACTGACGATTCTTACAACCACCCAGAAGAC
ATCGAACACTTCGGCCATCATGAAGGTATAGAGCGCGAAGAGGCTGAGCGTGAAGCCAAATTTGCTGGCGTGTCC
GTCGAGGAGATTCTTGCCGCACAGAGAGCTGCCGAAGAAGAGGCAGCAAAGCGTACAGCAGCTCAACAAGACATT
AATAACCAACAAAATTTGAATGCAGTCGACCCCAATGCACCTCCTGCACGATCACCCGTAATTCGTGTCACTCCT
CCCGAGAAACAAGATCCCTCTGTTAAATATGCTGGCGAGAAACCACATGGAGAGGAGTGGGGTACTGGTGACCAA
GGGTACAAGAGCCCTCGCGATGCAAGCGATAAACTGAGGAAGAACTTGCCTTACAAGTACAAATTCCGTAGGAAT
TGGGGAGATTTCTGA
Gene >AgabiH97|002530
ATGTTCACACGACCGCTGGCCAGCCTTTCTCTTCTCGCTCTTGCACACTATGCAGCCGCTCATGGCGGTCATGGA
GAAAGTGGTCCAAAAGCTGGTGAAACTATGCAGCAATACGCACAAAGACACGTAAGTTGTTAACAATTGAATCTT
AGTTGGTGTGCTGACTTGTCCTTCTAGATGTCTTCAGAACACCATATGTGAGTTTAACGTAGTCATTGTGTGTTG
GTATTGTGTCAATGCGTGGACCGTTGCGAACTAGTGACTCCTTCGATGCACCAAGTTTCTTCCAGTTACATGACC
TAAATCGGTGAGTCAAATTCAAAATCGTCCCAGTATCAGTCACTCATCGCCCAATTCATTAAGGGATGGTATCTG
GGACAGATCTGAAATTGAAGCAGTATATGGCGTTCACCACGTTTATTCACAAAAAAAATCCAAAGTATGTCCAAG
GAAAGTTAATTAGCCAATAGCTTAATATTGTCGACATTGCAGGATGACGAGGAACACCAAAAGAAAGCGGATACA
ATTGTCGATGCAGTACTACGGATTCTCGACTCGAACCGTGACGGTGTGGTGGACTTGAAAGAACTGGAAAGGCGC
GGAGTTGACGCTCTACCGACTTTCGACCATATGGGAGCTGAGGGCCACCACTACGATGTGGAAAGTGGTATGTAA
TGATTGCTTGCTTTCTTGCCTGAACACCGCTAACCAATATGCGAACAAATACAGAATTCTTTCTTCACCATGAAG
GTACTCTTACCGCGTGACAATTTCCAACAAAAGTTCACTCACACACCTCTTTCCTTCTCAATTACAGAGGAATTC
CATTCAACACCCGAAACCCAAACTGACGATTCTTACAACCACCCAGAAGACATCGAACACTTCGGCCATCATGAA
GGTATAGAGCGCGAAGAGGCTGAGCGTGAAGCCAAATTTGCTGGCGTGTCCGTCGAGGAGATTCTTGCCGCACAG
AGAGCTGCCGAAGAAGAGGCAGCAAAGCGTACAGCAGCTCAACAAGACATTAATAACCAACAAAATTTGAATGCA
GTCGACCCCAATGCACCTCCTGCACGATCACCCGTAATTCGTGTCACTCCTCCCGAGAAACAAGATCCCTCTGTT
AAATATGCTGGCGAGAAACCACATGGAGAGGAGTGGGGTACTGGTGACCAAGGGTACAAGAGCCCTCGCGATGCA
AGCGATAAACTGAGGAAGAACTTGCCTTACAAGGTATAATTCTCTATACTATTTTCACCATGTTGCGCTGAGGGC
TGATCCAGTCTCGTATGCAGTACAAATTCCGTAGGAATTGGGGAGATTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail