Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|002480
Gene name
Locationscaffold_1:633575..634805
Strand-
Gene length (bp)1230
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10354 BMT5-like rRNA (uridine-N3-)-methyltransferase BTM5-like 1.8E-49 68 260

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94480|BMT5_SCHPO 25S rRNA (uridine-N(3))-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bmt5 PE=3 SV=1 12 256 1.0E-32
sp|P40493|BMT5_YEAST 25S rRNA (uridine(2634)-N(3))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BMT5 PE=1 SV=1 3 271 2.0E-23
sp|P0C8L4|Y4648_ARATH Uncharacterized protein At4g26485 OS=Arabidopsis thaliana GN=At4g26485 PE=4 SV=1 67 201 1.0E-18
sp|Q3UY23|FDXA1_MOUSE Ferredoxin-fold anticodon-binding domain-containing protein 1 homolog OS=Mus musculus GN=Fdxacb1 PE=2 SV=2 67 190 2.0E-13
sp|Q9BRP7|FDXA1_HUMAN Ferredoxin-fold anticodon-binding domain-containing protein 1 OS=Homo sapiens GN=FDXACB1 PE=1 SV=3 67 192 9.0E-12

GO

GO Term Description Terminal node
GO:0070475 rRNA base methylation Yes
GO:0070042 rRNA (uridine-N3-)-methyltransferase activity Yes
GO:0140098 catalytic activity, acting on RNA No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043412 macromolecule modification No
GO:0008152 metabolic process No
GO:0140102 catalytic activity, acting on a rRNA No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0000154 rRNA modification No
GO:0032259 methylation No
GO:1901360 organic cyclic compound metabolic process No
GO:0006396 RNA processing No
GO:0031167 rRNA methylation No
GO:0008168 methyltransferase activity No
GO:0016070 RNA metabolic process No
GO:0034470 ncRNA processing No
GO:0008649 rRNA methyltransferase activity No
GO:0006364 rRNA processing No
GO:0016072 rRNA metabolic process No
GO:0043414 macromolecule methylation No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008170 N-methyltransferase activity No
GO:0003674 molecular_function No
GO:0001510 RNA methylation No
GO:0008173 RNA methyltransferase activity No
GO:0016740 transferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0009451 RNA modification No
GO:0034660 ncRNA metabolic process No
GO:0016436 rRNA (uridine) methyltransferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 13.70 6.81 20.60
Initials Initials knots 13.11 6.44 19.78
Pileal_Stipeal_center Stage I stipe center 9.95 4.72 15.17
Pileal_Stipeal_shell Stage I stipe shell 13.11 6.44 19.77
DIF_stipe_center Stage II stipe center 9.04 4.24 13.85
DIF_stipe_shell Stage II stipe shell 8.52 3.93 13.12
DIF_stipe_skin Stage II stipe skin 12.79 6.16 19.42
DIF_cap_skin Stage II cap skin 11.66 5.57 17.75
DIF_cap_tissue Stage II cap tissue 12.69 6.12 19.26
DIF_gill_tissue Stage II gill tissue 15.12 7.58 22.65
YFB_stipe_center Young fruiting body stipe center 11.23 5.34 17.12
YFB_stipe_shell Young fruiting body stipe shell 8.60 3.94 13.26
YFB_stipe_skin Young fruiting body stipe skin 12.13 5.91 18.35
YFB_cap_skin Young fruiting body cap skin 10.75 5.17 16.33
YFB_cap_tissue Young fruiting body cap tissue 7.86 3.60 12.12
YFB_gill_tissue Young fruiting body gill tissue 10.08 4.78 15.37
YFB_veil Young fruiting body veil 12.15 5.92 18.38

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.870376 no
Casing YFB_stipe_center 0.700459 no
Casing YFB_stipe_shell 0.240931 no
Casing YFB_stipe_skin 0.837851 no
Casing YFB_cap_skin 0.609496 no
Casing YFB_cap_tissue 0.134864 no
Casing YFB_gill_tissue 0.486122 no
Casing YFB_veil 0.839383 no
Casing Initials 0.945407 no
Casing Pileal_Stipeal_center 0.458448 no
Casing Pileal_Stipeal_shell 0.948047 no
Casing DIF_stipe_center 0.313441 no
Casing DIF_stipe_shell 0.227150 no
Casing DIF_stipe_skin 0.916889 no
Casing DIF_cap_skin 0.767023 no
Casing DIF_cap_tissue 0.904184 no
DIF_gill_tissue YFB_stipe_center 0.507422 no
DIF_gill_tissue YFB_stipe_shell 0.135445 no
DIF_gill_tissue YFB_stipe_skin 0.656135 no
DIF_gill_tissue YFB_cap_skin 0.415001 no
DIF_gill_tissue YFB_cap_tissue 0.066584 no
DIF_gill_tissue YFB_gill_tissue 0.305427 no
DIF_gill_tissue YFB_veil 0.655336 no
YFB_stipe_center YFB_stipe_shell 0.594174 no
YFB_stipe_center YFB_stipe_skin 0.908793 no
YFB_stipe_center YFB_cap_skin 0.948525 no
YFB_stipe_center YFB_cap_tissue 0.420563 no
YFB_stipe_center YFB_gill_tissue 0.863102 no
YFB_stipe_center YFB_veil 0.905932 no
YFB_stipe_shell YFB_stipe_skin 0.440629 no
YFB_stipe_shell YFB_cap_skin 0.668023 no
YFB_stipe_shell YFB_cap_tissue 0.895531 no
YFB_stipe_shell YFB_gill_tissue 0.787262 no
YFB_stipe_shell YFB_veil 0.435358 no
YFB_stipe_skin YFB_cap_skin 0.840993 no
YFB_stipe_skin YFB_cap_tissue 0.296701 no
YFB_stipe_skin YFB_gill_tissue 0.732050 no
YFB_stipe_skin YFB_veil 0.997634 no
YFB_cap_skin YFB_cap_tissue 0.500609 no
YFB_cap_skin YFB_gill_tissue 0.924757 no
YFB_cap_skin YFB_veil 0.840563 no
YFB_cap_tissue YFB_gill_tissue 0.625840 no
YFB_cap_tissue YFB_veil 0.288092 no
YFB_gill_tissue YFB_veil 0.722850 no
Initials DIF_gill_tissue 0.792957 no
Initials YFB_stipe_center 0.776396 no
Initials YFB_stipe_shell 0.300496 no
Initials YFB_stipe_skin 0.902827 no
Initials YFB_cap_skin 0.692917 no
Initials YFB_cap_tissue 0.172307 no
Initials YFB_gill_tissue 0.572392 no
Initials YFB_veil 0.905761 no
Initials Pileal_Stipeal_center 0.543011 no
Initials Pileal_Stipeal_shell 0.998680 no
Initials DIF_stipe_center 0.387524 no
Initials DIF_stipe_shell 0.287100 no
Initials DIF_stipe_skin 0.971408 no
Initials DIF_cap_skin 0.840397 no
Initials DIF_cap_tissue 0.961619 no
Pileal_Stipeal_center DIF_gill_tissue 0.288793 no
Pileal_Stipeal_center YFB_stipe_center 0.842745 no
Pileal_Stipeal_center YFB_stipe_shell 0.811887 no
Pileal_Stipeal_center YFB_stipe_skin 0.710508 no
Pileal_Stipeal_center YFB_cap_skin 0.906321 no
Pileal_Stipeal_center YFB_cap_tissue 0.649031 no
Pileal_Stipeal_center YFB_gill_tissue 0.985328 no
Pileal_Stipeal_center YFB_veil 0.701274 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.561022 no
Pileal_Stipeal_center DIF_stipe_center 0.885659 no
Pileal_Stipeal_center DIF_stipe_shell 0.793802 no
Pileal_Stipeal_center DIF_stipe_skin 0.604439 no
Pileal_Stipeal_center DIF_cap_skin 0.777280 no
Pileal_Stipeal_center DIF_cap_tissue 0.619450 no
Pileal_Stipeal_shell DIF_gill_tissue 0.801872 no
Pileal_Stipeal_shell YFB_stipe_center 0.785993 no
Pileal_Stipeal_shell YFB_stipe_shell 0.319242 no
Pileal_Stipeal_shell YFB_stipe_skin 0.906485 no
Pileal_Stipeal_shell YFB_cap_skin 0.707255 no
Pileal_Stipeal_shell YFB_cap_tissue 0.192047 no
Pileal_Stipeal_shell YFB_gill_tissue 0.588261 no
Pileal_Stipeal_shell YFB_veil 0.909322 no
Pileal_Stipeal_shell DIF_stipe_center 0.404441 no
Pileal_Stipeal_shell DIF_stipe_shell 0.304111 no
Pileal_Stipeal_shell DIF_stipe_skin 0.972836 no
Pileal_Stipeal_shell DIF_cap_skin 0.847394 no
Pileal_Stipeal_shell DIF_cap_tissue 0.963248 no
DIF_stipe_center DIF_gill_tissue 0.185461 no
DIF_stipe_center YFB_stipe_center 0.680539 no
DIF_stipe_center YFB_stipe_shell 0.945061 no
DIF_stipe_center YFB_stipe_skin 0.536319 no
DIF_stipe_center YFB_cap_skin 0.758544 no
DIF_stipe_center YFB_cap_tissue 0.820445 no
DIF_stipe_center YFB_gill_tissue 0.864757 no
DIF_stipe_center YFB_veil 0.529634 no
DIF_stipe_center DIF_stipe_shell 0.933774 no
DIF_stipe_center DIF_stipe_skin 0.441147 no
DIF_stipe_center DIF_cap_skin 0.611613 no
DIF_stipe_center DIF_cap_tissue 0.452955 no
DIF_stipe_shell DIF_gill_tissue 0.123057 no
DIF_stipe_shell YFB_stipe_center 0.568646 no
DIF_stipe_shell YFB_stipe_shell 0.990695 no
DIF_stipe_shell YFB_stipe_skin 0.423104 no
DIF_stipe_shell YFB_cap_skin 0.648885 no
DIF_stipe_shell YFB_cap_tissue 0.907292 no
DIF_stipe_shell YFB_gill_tissue 0.768731 no
DIF_stipe_shell YFB_veil 0.416901 no
DIF_stipe_shell DIF_stipe_skin 0.336508 no
DIF_stipe_shell DIF_cap_skin 0.500239 no
DIF_stipe_shell DIF_cap_tissue 0.345643 no
DIF_stipe_skin DIF_gill_tissue 0.759336 no
DIF_stipe_skin YFB_stipe_center 0.827921 no
DIF_stipe_skin YFB_stipe_shell 0.354295 no
DIF_stipe_skin YFB_stipe_skin 0.939373 no
DIF_stipe_skin YFB_cap_skin 0.751548 no
DIF_stipe_skin YFB_cap_tissue 0.218316 no
DIF_stipe_skin YFB_gill_tissue 0.634833 no
DIF_stipe_skin YFB_veil 0.940527 no
DIF_stipe_skin DIF_cap_skin 0.883387 no
DIF_stipe_skin DIF_cap_tissue 0.990559 no
DIF_cap_skin DIF_gill_tissue 0.581604 no
DIF_cap_skin YFB_stipe_center 0.957408 no
DIF_cap_skin YFB_stipe_shell 0.522533 no
DIF_cap_skin YFB_stipe_skin 0.956030 no
DIF_cap_skin YFB_cap_skin 0.900497 no
DIF_cap_skin YFB_cap_tissue 0.358057 no
DIF_cap_skin YFB_gill_tissue 0.803101 no
DIF_cap_skin YFB_veil 0.953316 no
DIF_cap_skin DIF_cap_tissue 0.894718 no
DIF_cap_tissue DIF_gill_tissue 0.746725 no
DIF_cap_tissue YFB_stipe_center 0.841964 no
DIF_cap_tissue YFB_stipe_shell 0.370496 no
DIF_cap_tissue YFB_stipe_skin 0.948481 no
DIF_cap_tissue YFB_cap_skin 0.765672 no
DIF_cap_tissue YFB_cap_tissue 0.228595 no
DIF_cap_tissue YFB_gill_tissue 0.651288 no
DIF_cap_tissue YFB_veil 0.950227 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|002480
MGKGLKAALKSQQSRLKEKEKAQKAARAADLKYKKTTTYASSAKSKAKEKVLSNQKPTIPFLPSDDILLVGEGNF
SFARALAFHPPSGSGLEDLPPQNITATAYDSEEECFVKYPEAKDIVQNLRERGVEVLFNIDATKLDKISGVKGRK
WDRVVWNFPHAGKGITDQDRNILSNQVLVLDFLRSAAKVLRDGLIPSIHKPKRKPVEAADESEDEGVPNPDDMNE
APSNSKARGTVLITLRNVPPYTLWEVPRLAKKPPLPKTGSKFAREHTVLERLAKVVRTELGNFVFVIKSPNNNDC
LDGVDEIWLTWRSPSSLMIW*
Coding >AgabiH97|002480
ATGGGCAAAGGCCTCAAAGCAGCGCTCAAATCTCAGCAATCCAGGCTAAAAGAGAAGGAAAAGGCTCAGAAGGCA
GCTAGGGCTGCAGATCTCAAGTACAAGAAGACCACCACATATGCTTCGTCTGCGAAATCCAAAGCTAAAGAAAAA
GTTCTGTCTAACCAGAAACCCACTATACCTTTCTTACCATCGGATGACATTCTTCTTGTCGGCGAAGGGAACTTT
TCATTTGCGCGCGCATTAGCATTTCACCCACCTTCTGGTTCTGGACTCGAGGACCTGCCACCGCAAAATATTACC
GCTACAGCGTACGATTCAGAAGAAGAATGCTTTGTTAAATATCCTGAAGCAAAAGATATCGTTCAGAACCTGCGA
GAACGAGGCGTAGAAGTTCTTTTTAATATCGACGCAACGAAATTGGATAAGATTTCCGGTGTCAAGGGAAGGAAA
TGGGATCGTGTTGTATGGAACTTTCCTCACGCAGGAAAAGGAATCACAGACCAGGACAGGAACATACTTTCTAAT
CAAGTATTGGTCCTGGACTTCCTCCGATCAGCTGCCAAAGTGCTTAGAGACGGACTAATACCTTCAATTCACAAA
CCTAAAAGGAAACCCGTTGAAGCTGCCGATGAGAGCGAAGACGAAGGTGTTCCTAACCCCGACGACATGAATGAA
GCACCAAGCAACTCGAAGGCGCGAGGTACCGTCCTCATCACTTTGCGGAACGTCCCACCATACACGCTGTGGGAA
GTACCGAGACTTGCAAAGAAGCCTCCATTGCCAAAGACAGGGAGCAAGTTCGCGAGAGAGCACACGGTGTTGGAA
AGACTGGCGAAGGTGGTGAGGACCGAACTTGGGAATTTTGTCTTCGTGATTAAATCTCCCAATAATAATGATTGC
TTGGATGGTGTAGATGAGATCTGGCTGACTTGGCGTTCACCTAGCTCATTGATGATTTGGTGA
Transcript >AgabiH97|002480
ATGGGCAAAGGCCTCAAAGCAGCGCTCAAATCTCAGCAATCCAGGCTAAAAGAGAAGGAAAAGGCTCAGAAGGCA
GCTAGGGCTGCAGATCTCAAGTACAAGAAGACCACCACATATGCTTCGTCTGCGAAATCCAAAGCTAAAGAAAAA
GTTCTGTCTAACCAGAAACCCACTATACCTTTCTTACCATCGGATGACATTCTTCTTGTCGGCGAAGGGAACTTT
TCATTTGCGCGCGCATTAGCATTTCACCCACCTTCTGGTTCTGGACTCGAGGACCTGCCACCGCAAAATATTACC
GCTACAGCGTACGATTCAGAAGAAGAATGCTTTGTTAAATATCCTGAAGCAAAAGATATCGTTCAGAACCTGCGA
GAACGAGGCGTAGAAGTTCTTTTTAATATCGACGCAACGAAATTGGATAAGATTTCCGGTGTCAAGGGAAGGAAA
TGGGATCGTGTTGTATGGAACTTTCCTCACGCAGGAAAAGGAATCACAGACCAGGACAGGAACATACTTTCTAAT
CAAGTATTGGTCCTGGACTTCCTCCGATCAGCTGCCAAAGTGCTTAGAGACGGACTAATACCTTCAATTCACAAA
CCTAAAAGGAAACCCGTTGAAGCTGCCGATGAGAGCGAAGACGAAGGTGTTCCTAACCCCGACGACATGAATGAA
GCACCAAGCAACTCGAAGGCGCGAGGTACCGTCCTCATCACTTTGCGGAACGTCCCACCATACACGCTGTGGGAA
GTACCGAGACTTGCAAAGAAGCCTCCATTGCCAAAGACAGGGAGCAAGTTCGCGAGAGAGCACACGGTGTTGGAA
AGACTGGCGAAGGTGGTGAGGACCGAACTTGGGAATTTTGTCTTCGTGATTAAATCTCCCAATAATAATGATTGC
TTGGATGGTGTAGATGAGATCTGGCTGACTTGGCGTTCACCTAGCTCATTGATGATTTGGTGA
Gene >AgabiH97|002480
ATGGGCAAAGGCCTCAAAGCAGCGCTCAAATCTCAGCAATCCAGGCTAAAAGAGAAGGAAAAGGCTCAGAAGGCA
GCTAGGGCTGCAGATCTCAAGTACAAGAAGACCACCACATATGCTTCGTCTGCGAAATCCAAAGCTAAAGAAAAA
GTTCTGTCTAACCAGAAACCCACTATACCTTTCTTACCATCGGATGACATTCTTCTTGTCGGCGAAGGGAACTTT
TCATTTGCGCGCGCATTAGCATTTCACCCACCTTCTGGTTCTGGACTCGAGGACCTGCCACCGCAAAATATTACC
GCTACAGCGTACGATTCAGAAGAAGAATGCTTTGTTAAATATCCTGAAGCAAAAGATATCGTTCAGAACCTGCGA
GAACGAGGCGTAGAAGTTCTTTTTAATATCGACGCAACGAAATTGGATAAGATTTCCGGTGTCAAGGGAAGGAAA
TGGGATCGTGTTGTATGGAACTTTCCTCACGCAGGTGCGCACCCACTGTCATTCCATTACCGACAAGTAATTGAG
GATTTCGCGTTCTTGCAGGAAAAGGAATCACAGACCAGGACAGGAACATACTTTCTAATCAAGTATTGGTCCTGG
ACTTCCTCCGATCAGCTGCCAAAGTGCTTAGAGACGGACTAATACCTTCAATTCACAAACCTAAAAGGAAACCCG
TTGAAGCTGCCGATGAGAGCGAAGACGAAGGTGTTCCTAACCCCGACGACATGAATGAAGCACCAAGCAACTCGA
AGGCGCGAGGTACCGTCCTCATCACTTTGCGGAACGTCCCACCATACACGCTGTGGTAATCATCTTTTCCCTATT
GCCCAAATTGACACCTTATGTCTGCTGGTTATTTCACAGGGAAGTACCGAGACTTGCAAAGAAGCCTCCATTGCC
AAAGACAGGGAGCAAGTTCGTAAACCCGCAGTATATTCAACTTCGTTCCTTCGCGTTCCATCGTAATGCCTGGAA
AAGTTACGAACACCGAATGACTAAAGGCGAGAGAGCACACGGTGTTGGAAAGACTGGCGAAGGTGGTGAGGACCG
AACTTGGGAATTTTGTCTTCGTGATTAAATCTCCCAATAATAATGATTGTATGTGCCTTCTGAGTCGTCCTTCCA
AAATCACTGACTCTCGCTCCTCCCCGATTGGTCACGAAAGGCTTGGATGGTGTAGATGAGATCTGGCTGACTTGG
CGTTCACCTAGCTCATTGATGATTTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail