Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|002320
Gene name
Locationscaffold_1:588735..591800
Strand-
Gene length (bp)3065
Transcript length (bp)2865
Coding sequence length (bp)2865
Protein length (aa) 955

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16016 VASt VAD1 Analog of StAR-related lipid transfer domain 3.1E-36 579 724
PF02893 GRAM GRAM domain 2.9E-21 419 527

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42976|YGZ7_SCHPO Uncharacterized membrane protein C20F10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC20F10.07 PE=1 SV=1 406 527 4.0E-42
sp|Q96CP6|GRM1A_HUMAN GRAM domain-containing protein 1A OS=Homo sapiens GN=GRAMD1A PE=1 SV=2 414 525 8.0E-31
sp|Q8VEF1|GRM1A_MOUSE GRAM domain-containing protein 1A OS=Mus musculus GN=Gramd1a PE=1 SV=2 414 525 8.0E-31
sp|Q3KR56|GRM1A_RAT GRAM domain-containing protein 1A OS=Rattus norvegicus GN=Gramd1a PE=2 SV=2 414 525 8.0E-31
sp|Q06681|YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP2 PE=1 SV=1 402 522 1.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42976|YGZ7_SCHPO Uncharacterized membrane protein C20F10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC20F10.07 PE=1 SV=1 406 527 4.0E-42
sp|Q96CP6|GRM1A_HUMAN GRAM domain-containing protein 1A OS=Homo sapiens GN=GRAMD1A PE=1 SV=2 414 525 8.0E-31
sp|Q8VEF1|GRM1A_MOUSE GRAM domain-containing protein 1A OS=Mus musculus GN=Gramd1a PE=1 SV=2 414 525 8.0E-31
sp|Q3KR56|GRM1A_RAT GRAM domain-containing protein 1A OS=Rattus norvegicus GN=Gramd1a PE=2 SV=2 414 525 8.0E-31
sp|Q06681|YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP2 PE=1 SV=1 402 522 1.0E-29
sp|P38800|LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM4 PE=1 SV=1 406 522 1.0E-29
sp|Q3KR37|GRM1B_HUMAN GRAM domain-containing protein 1B OS=Homo sapiens GN=GRAMD1B PE=1 SV=1 415 527 6.0E-28
sp|Q80TI0|GRM1B_MOUSE GRAM domain-containing protein 1B OS=Mus musculus GN=Gramd1b PE=1 SV=2 415 527 6.0E-28
sp|Q8IYS0|GRM1C_HUMAN GRAM domain-containing protein 1C OS=Homo sapiens GN=GRAMD1C PE=1 SV=2 416 531 5.0E-27
sp|Q5RC33|GRM1C_PONAB GRAM domain-containing protein 1C OS=Pongo abelii GN=GRAMD1C PE=2 SV=1 416 531 5.0E-27
sp|P43560|LAM5_YEAST Membrane-anchored lipid-binding protein LAM5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM5 PE=1 SV=2 407 522 2.0E-26
sp|Q96HH9|GRAM3_HUMAN GRAM domain-containing protein 3 OS=Homo sapiens GN=GRAMD3 PE=1 SV=1 415 537 3.0E-25
sp|Q6PEM6|GRAM3_MOUSE GRAM domain-containing protein 3 OS=Mus musculus GN=Gramd3 PE=1 SV=2 415 537 3.0E-25
sp|Q5R8N8|GRAM3_PONAB GRAM domain-containing protein 3 OS=Pongo abelii GN=GRAMD3 PE=2 SV=1 415 537 4.0E-25
sp|Q5FVG8|GRAM3_RAT GRAM domain-containing protein 3 OS=Rattus norvegicus GN=Gramd3 PE=1 SV=1 415 537 5.0E-25
sp|Q8IUY3|GRAM2_HUMAN GRAM domain-containing protein 2 OS=Homo sapiens GN=GRAMD2 PE=2 SV=2 357 540 3.0E-24
sp|Q06681|YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP2 PE=1 SV=1 630 724 5.0E-21
sp|Q3V3G7|GRAM2_MOUSE GRAM domain-containing protein 2 OS=Mus musculus GN=Gramd2 PE=2 SV=1 414 521 6.0E-21
sp|P38800|LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM4 PE=1 SV=1 583 726 5.0E-20
sp|F4HVW5|VAD1_ARATH Protein VASCULAR ASSOCIATED DEATH 1, chloroplastic OS=Arabidopsis thaliana GN=VAD1 PE=1 SV=1 416 522 5.0E-20
sp|O42976|YGZ7_SCHPO Uncharacterized membrane protein C20F10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC20F10.07 PE=1 SV=1 590 739 4.0E-19
sp|P38800|LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM4 PE=1 SV=1 630 724 2.0E-17
sp|P43560|LAM5_YEAST Membrane-anchored lipid-binding protein LAM5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM5 PE=1 SV=2 576 746 4.0E-17
sp|Q08001|LAM6_YEAST Membrane-anchored lipid-binding protein LAM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM6 PE=1 SV=1 395 522 5.0E-17
sp|Q06681|YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP2 PE=1 SV=1 630 740 6.0E-16
sp|Q08001|LAM6_YEAST Membrane-anchored lipid-binding protein LAM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM6 PE=1 SV=1 630 743 2.0E-14
sp|Q6ZT07|TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens GN=TBC1D9 PE=2 SV=2 420 525 2.0E-09
sp|Q3UYK3|TBCD9_MOUSE TBC1 domain family member 9 OS=Mus musculus GN=Tbc1d9 PE=2 SV=2 420 525 1.0E-08
sp|Q5SVR0|TBC9B_MOUSE TBC1 domain family member 9B OS=Mus musculus GN=Tbc1d9b PE=1 SV=1 427 525 5.0E-08
sp|Q66K14|TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens GN=TBC1D9B PE=1 SV=3 427 525 6.0E-08
sp|Q80TI0|GRM1B_MOUSE GRAM domain-containing protein 1B OS=Mus musculus GN=Gramd1b PE=1 SV=2 582 736 2.0E-07
sp|Q9Z1A9|TBCD8_MOUSE TBC1 domain family member 8 OS=Mus musculus GN=Tbc1d8 PE=1 SV=2 393 560 7.0E-07
sp|Q8MVR1|GBPC_DICDI Cyclic GMP-binding protein C OS=Dictyostelium discoideum GN=gbpC PE=1 SV=1 415 522 1.0E-06
sp|O95759|TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens GN=TBC1D8 PE=2 SV=3 393 560 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 828 850 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|002320
MARAFLLKLVKATHARGGSDRSDRSNRSEPSDSGQSSISKTTREDPTTPTSSNTSADTPPKITINDKGTESRSSL
RTEFSSSSSQQPVVTVVPPSPHSSLLQLGEPSDRRTMSGDVNTRDAKDLDRTTPIITSSAHHHHSVSSRPPRTSP
PSPPPTGPAPPPLSPVPEENTRTNTSSPMAKTLDPSPQTRVRRSPSAKSLTMAESDAVMQRPLVESPTAIRADLP
SVDSTNGTSSLHPSRDSDAASLASTNQNGTTKDKKRPWRKSTARKPTGLAGAIAASGMAMAQPTLSAIHQASFSA
TMQAQAQPNAPSTSTTRKSSINSPPRSPRGSVINHARGKSSEFSPHSTRSKRSGAGRASVSVQSDNASEYYPDDR
PDYYSGLDESSDEDEGLEGESMLDEMEDMPVTGFAVASNKRNADFHDLFPTVPEGDYLIEDYGCALQREILIQGR
LYISENHICFHANIFGWITNMSIPMCEVTQLDKRMTAFVIPNAIQATTRQAKYTFASFLSRDTTYDVIYNIWRLA
KPDDAINSSRPSFDGASVVESNPIQGNGEGALLRAPKITTCACAEGGHYHETAMDCVLPGTPDRIHNLIFASAFI
KEFMTVDQKLTDIQISDWQPTEPGSALLTRNMSYIKPLHGSVGPRSTKCEITDLMVYKDSEHYISTDTTTRTPDV
PSGGVFSVKTKTCLTWASSLSTRIVVTTEVQWTGRSFIKSIIEKSAIEGQKTWHRDLEIAMRAYIQEHQAEFVPE
GVDASALPASPNPNVPPTPGEVTISSKEANKRREHERNRRGLQWAWDTFEGASQVAIRSTKDAFELVCDAWEQSS
STTIMWFVIVGLVLSNLWSLFLMGSREEAGRRKEMKKMEEREKWVQGVVRALWDELSKQQPHKEHLSMPSDGISW
VAGLAQSQPVPAATWSREVEDMQGVLDQLEERIKLLNEGLKVIRTEGGGIDSLD*
Coding >AgabiH97|002320
ATGGCGCGTGCGTTCCTGCTAAAGCTTGTGAAGGCTACCCATGCTCGAGGCGGTTCAGATCGTTCAGATCGTTCA
AACCGTTCAGAACCGTCAGATTCGGGTCAGAGCAGTATCTCCAAGACTACACGAGAGGATCCCACGACTCCCACT
TCCTCCAACACCTCAGCCGATACCCCACCCAAAATCACGATCAACGACAAGGGCACGGAGAGCAGGTCGTCTCTC
CGCACAGAGTTCTCATCGAGCAGCTCGCAGCAGCCTGTGGTGACAGTGGTACCGCCATCGCCGCATTCGTCGTTG
TTGCAACTCGGCGAGCCGTCGGACCGGCGTACTATGAGTGGTGATGTGAATACCAGGGATGCCAAGGACCTGGAT
CGTACGACACCAATAATTACTTCCTCTGCTCATCACCACCACTCAGTCTCTTCACGCCCTCCTCGCACGTCGCCA
CCGTCGCCGCCTCCCACGGGCCCGGCCCCGCCACCGCTCAGCCCCGTCCCAGAAGAGAACACACGAACAAATACG
TCATCTCCTATGGCCAAAACACTCGATCCCTCGCCTCAGACCCGCGTCCGACGTTCTCCTTCCGCCAAATCCCTC
ACCATGGCAGAATCAGACGCAGTCATGCAGAGGCCCCTCGTCGAGTCTCCCACCGCAATCAGGGCTGACCTGCCC
AGTGTCGACTCAACAAATGGAACTTCTTCCTTGCATCCATCCCGAGACTCAGACGCTGCATCCCTCGCCTCCACT
AATCAAAATGGCACTACAAAAGACAAGAAACGCCCGTGGAGGAAATCCACCGCTCGCAAGCCTACGGGTCTCGCA
GGTGCCATCGCAGCATCCGGCATGGCCATGGCGCAGCCCACCCTTTCAGCTATCCACCAAGCTTCATTCTCTGCC
ACCATGCAAGCTCAAGCCCAGCCTAACGCTCCCTCTACCTCAACCACCAGAAAATCTTCTATAAATTCACCTCCC
CGTTCCCCGCGGGGCTCAGTCATAAATCATGCCAGGGGGAAGTCCTCTGAGTTTTCGCCACATTCAACCAGATCC
AAACGCTCTGGTGCAGGACGGGCATCTGTCTCAGTGCAAAGTGACAATGCCTCAGAATACTACCCAGATGACAGA
CCTGACTACTATTCCGGCTTGGACGAGAGTTCAGACGAGGACGAGGGTCTGGAGGGTGAATCAATGTTGGACGAA
ATGGAGGATATGCCCGTCACTGGGTTTGCCGTCGCCAGCAACAAGCGGAATGCTGATTTCCACGACCTCTTCCCC
ACCGTCCCTGAAGGCGACTATTTGATTGAAGACTACGGTTGTGCCCTACAGCGGGAAATATTGATTCAAGGCCGT
CTCTATATCTCTGAAAATCACATATGCTTCCATGCCAATATATTCGGCTGGATCACTAATATGTCGATCCCAATG
TGCGAAGTCACTCAGCTCGATAAGCGCATGACCGCCTTCGTGATCCCCAACGCCATCCAGGCCACAACGCGGCAA
GCTAAATATACTTTCGCTTCCTTCCTCTCCCGCGATACGACCTACGACGTGATTTATAATATCTGGAGACTGGCT
AAACCTGACGACGCCATCAATAGCAGTCGCCCCTCTTTTGACGGCGCCTCAGTCGTCGAGTCAAATCCGATCCAG
GGCAACGGGGAGGGGGCTTTGCTGAGAGCCCCTAAAATCACGACCTGTGCATGTGCAGAGGGTGGTCATTACCAC
GAAACAGCGATGGATTGTGTGCTGCCTGGCACCCCTGATCGGATACATAATTTAATCTTTGCTAGTGCATTCATC
AAAGAGTTCATGACTGTCGATCAAAAGCTAACCGACATTCAAATTTCGGATTGGCAACCTACCGAGCCGGGTTCT
GCTCTTCTTACTCGAAATATGTCTTATATCAAGCCCCTGCATGGCAGCGTCGGACCGAGATCTACCAAGTGCGAA
ATTACCGACCTTATGGTTTACAAAGACTCCGAACATTACATTTCGACTGATACAACAACGCGGACACCAGATGTA
CCTAGCGGTGGCGTATTTTCTGTAAAGACGAAAACGTGTTTGACATGGGCAAGCTCTTTATCGACGAGGATAGTT
GTAACGACCGAGGTGCAATGGACTGGTCGTAGTTTCATCAAATCCATCATCGAAAAGTCAGCCATCGAAGGGCAA
AAGACGTGGCACAGGGACTTGGAAATTGCCATGCGAGCTTACATCCAAGAACATCAAGCCGAGTTCGTACCCGAA
GGTGTCGATGCGTCTGCTCTTCCAGCTTCGCCCAATCCAAACGTTCCGCCTACACCAGGAGAGGTGACAATATCA
TCGAAAGAAGCAAATAAACGACGGGAACATGAAAGAAATCGACGTGGTTTACAATGGGCTTGGGATACATTTGAA
GGTGCTTCGCAAGTCGCTATACGGAGTACGAAAGACGCGTTTGAACTTGTTTGTGATGCTTGGGAACAATCGTCA
AGTACGACCATAATGTGGTTTGTGATTGTCGGTCTTGTCTTGAGCAATCTATGGTCGTTGTTTTTGATGGGGTCG
AGAGAAGAAGCTGGAAGGAGGAAAGAGATGAAAAAGATGGAAGAGAGAGAGAAATGGGTACAAGGTGTTGTTAGA
GCTTTATGGGATGAACTCTCAAAACAACAACCGCATAAAGAGCATTTATCGATGCCGTCGGATGGGATTTCTTGG
GTTGCGGGTCTGGCGCAATCGCAACCTGTGCCTGCTGCGACGTGGAGTAGGGAGGTGGAGGATATGCAGGGTGTT
TTGGATCAGTTGGAGGAGAGGATTAAACTTTTGAATGAGGGTTTGAAGGTGATTAGGACGGAGGGGGGAGGGATT
GATTCATTAGATTGA
Transcript >AgabiH97|002320
ATGGCGCGTGCGTTCCTGCTAAAGCTTGTGAAGGCTACCCATGCTCGAGGCGGTTCAGATCGTTCAGATCGTTCA
AACCGTTCAGAACCGTCAGATTCGGGTCAGAGCAGTATCTCCAAGACTACACGAGAGGATCCCACGACTCCCACT
TCCTCCAACACCTCAGCCGATACCCCACCCAAAATCACGATCAACGACAAGGGCACGGAGAGCAGGTCGTCTCTC
CGCACAGAGTTCTCATCGAGCAGCTCGCAGCAGCCTGTGGTGACAGTGGTACCGCCATCGCCGCATTCGTCGTTG
TTGCAACTCGGCGAGCCGTCGGACCGGCGTACTATGAGTGGTGATGTGAATACCAGGGATGCCAAGGACCTGGAT
CGTACGACACCAATAATTACTTCCTCTGCTCATCACCACCACTCAGTCTCTTCACGCCCTCCTCGCACGTCGCCA
CCGTCGCCGCCTCCCACGGGCCCGGCCCCGCCACCGCTCAGCCCCGTCCCAGAAGAGAACACACGAACAAATACG
TCATCTCCTATGGCCAAAACACTCGATCCCTCGCCTCAGACCCGCGTCCGACGTTCTCCTTCCGCCAAATCCCTC
ACCATGGCAGAATCAGACGCAGTCATGCAGAGGCCCCTCGTCGAGTCTCCCACCGCAATCAGGGCTGACCTGCCC
AGTGTCGACTCAACAAATGGAACTTCTTCCTTGCATCCATCCCGAGACTCAGACGCTGCATCCCTCGCCTCCACT
AATCAAAATGGCACTACAAAAGACAAGAAACGCCCGTGGAGGAAATCCACCGCTCGCAAGCCTACGGGTCTCGCA
GGTGCCATCGCAGCATCCGGCATGGCCATGGCGCAGCCCACCCTTTCAGCTATCCACCAAGCTTCATTCTCTGCC
ACCATGCAAGCTCAAGCCCAGCCTAACGCTCCCTCTACCTCAACCACCAGAAAATCTTCTATAAATTCACCTCCC
CGTTCCCCGCGGGGCTCAGTCATAAATCATGCCAGGGGGAAGTCCTCTGAGTTTTCGCCACATTCAACCAGATCC
AAACGCTCTGGTGCAGGACGGGCATCTGTCTCAGTGCAAAGTGACAATGCCTCAGAATACTACCCAGATGACAGA
CCTGACTACTATTCCGGCTTGGACGAGAGTTCAGACGAGGACGAGGGTCTGGAGGGTGAATCAATGTTGGACGAA
ATGGAGGATATGCCCGTCACTGGGTTTGCCGTCGCCAGCAACAAGCGGAATGCTGATTTCCACGACCTCTTCCCC
ACCGTCCCTGAAGGCGACTATTTGATTGAAGACTACGGTTGTGCCCTACAGCGGGAAATATTGATTCAAGGCCGT
CTCTATATCTCTGAAAATCACATATGCTTCCATGCCAATATATTCGGCTGGATCACTAATATGTCGATCCCAATG
TGCGAAGTCACTCAGCTCGATAAGCGCATGACCGCCTTCGTGATCCCCAACGCCATCCAGGCCACAACGCGGCAA
GCTAAATATACTTTCGCTTCCTTCCTCTCCCGCGATACGACCTACGACGTGATTTATAATATCTGGAGACTGGCT
AAACCTGACGACGCCATCAATAGCAGTCGCCCCTCTTTTGACGGCGCCTCAGTCGTCGAGTCAAATCCGATCCAG
GGCAACGGGGAGGGGGCTTTGCTGAGAGCCCCTAAAATCACGACCTGTGCATGTGCAGAGGGTGGTCATTACCAC
GAAACAGCGATGGATTGTGTGCTGCCTGGCACCCCTGATCGGATACATAATTTAATCTTTGCTAGTGCATTCATC
AAAGAGTTCATGACTGTCGATCAAAAGCTAACCGACATTCAAATTTCGGATTGGCAACCTACCGAGCCGGGTTCT
GCTCTTCTTACTCGAAATATGTCTTATATCAAGCCCCTGCATGGCAGCGTCGGACCGAGATCTACCAAGTGCGAA
ATTACCGACCTTATGGTTTACAAAGACTCCGAACATTACATTTCGACTGATACAACAACGCGGACACCAGATGTA
CCTAGCGGTGGCGTATTTTCTGTAAAGACGAAAACGTGTTTGACATGGGCAAGCTCTTTATCGACGAGGATAGTT
GTAACGACCGAGGTGCAATGGACTGGTCGTAGTTTCATCAAATCCATCATCGAAAAGTCAGCCATCGAAGGGCAA
AAGACGTGGCACAGGGACTTGGAAATTGCCATGCGAGCTTACATCCAAGAACATCAAGCCGAGTTCGTACCCGAA
GGTGTCGATGCGTCTGCTCTTCCAGCTTCGCCCAATCCAAACGTTCCGCCTACACCAGGAGAGGTGACAATATCA
TCGAAAGAAGCAAATAAACGACGGGAACATGAAAGAAATCGACGTGGTTTACAATGGGCTTGGGATACATTTGAA
GGTGCTTCGCAAGTCGCTATACGGAGTACGAAAGACGCGTTTGAACTTGTTTGTGATGCTTGGGAACAATCGTCA
AGTACGACCATAATGTGGTTTGTGATTGTCGGTCTTGTCTTGAGCAATCTATGGTCGTTGTTTTTGATGGGGTCG
AGAGAAGAAGCTGGAAGGAGGAAAGAGATGAAAAAGATGGAAGAGAGAGAGAAATGGGTACAAGGTGTTGTTAGA
GCTTTATGGGATGAACTCTCAAAACAACAACCGCATAAAGAGCATTTATCGATGCCGTCGGATGGGATTTCTTGG
GTTGCGGGTCTGGCGCAATCGCAACCTGTGCCTGCTGCGACGTGGAGTAGGGAGGTGGAGGATATGCAGGGTGTT
TTGGATCAGTTGGAGGAGAGGATTAAACTTTTGAATGAGGGTTTGAAGGTGATTAGGACGGAGGGGGGAGGGATT
GATTCATTAGATTGA
Gene >AgabiH97|002320
ATGGCGCGTGCGTTCCTGCTAAAGCTTGTGAAGGCTACCCATGCTCGAGGCGGTTCAGATCGTTCAGATCGTTCA
AACCGTTCAGAACCGTCAGATTCGGGTCAGAGCAGTATCTCCAAGACTACACGAGAGGATCCCACGACTCCCACT
TCCTCCAACACCTCAGCCGATACCCCACCCAAAATCACGATCAACGACAAGGGCACGGAGAGCAGGTCGTCTCTC
CGCACAGAGTTCTCATCGAGCAGCTCGCAGCAGCCTGTGGTGACAGTGGTACCGCCATCGCCGCATTCGTCGTTG
TTGCAACTCGGCGAGCCGTCGGACCGGCGTACTATGAGTGGTGATGTGAATACCAGGGATGCCAAGGACCTGGAT
CGTACGACACCAATAATTACTTCCTCTGCTCATCACCACCACTCAGTCTCTTCACGCCCTCCTCGCACGTCGCCA
CCGTCGCCGCCTCCCACGGGCCCGGCCCCGCCACCGCTCAGCCCCGTCCCAGAAGAGAACACACGAACAAATACG
TCATCTCCTATGGCCAAAACACTCGATCCCTCGCCTCAGACCCGCGTCCGACGTTCTCCTTCCGCCAAATCCCTC
ACCATGGCAGAATCAGACGCAGTCATGCAGAGGCCCCTCGTCGAGTCTCCCACCGCAATCAGGGCTGACCTGCCC
AGTGTCGACTCAACAAATGGAACTTCTTCCTTGCATCCATCCCGAGACTCAGACGCTGCATCCCTCGCCTCCACT
AATCAAAATGGCACTACAAAAGACAAGAAACGCCCGTGGAGGAAATCCACCGCTCGCAAGCCTACGGGTCTCGCA
GGTGCCATCGCAGCATCCGGCATGGCCATGGCGCAGCCCACCCTTTCAGCTATCCACCAAGCTTCATTCTCTGCC
ACCATGCAAGCTCAAGCCCAGCCTAACGCTCCCTCTACCTCAACCACCAGAAAATCTTCTATAAATTCACCTCCC
CGTTCCCCGCGGGGCTCAGTCATAAATCATGCCAGGGGGAAGTCCTCTGAGTTTTCGCCACATTCAACCAGATCC
AAACGCTCTGGTGCAGGACGGGCATCTGTCTCAGTGCAAAGTGACAATGCCTCAGAATACTACCCAGATGACAGA
CCTGACTACTATTCCGGCTTGGACGAGAGTTCAGACGAGGACGAGGGTCTGGAGGGTGAATCAATGTTGGACGAA
ATGGAGGATATGCCCGTCACTGGGTTTGCCGTCGCCAGCAACAAGCGGAATGCTGATTTCCACGACCTCTTCCCC
ACCGTCCCTGAAGGCGACTATTTGATTGAAGGTACAGCCATTTTCTGTCTCAACAACGGGCAGTAGTCTGACCAC
TTTTAGACTACGGTTGTGCCCTACAGCGGGAAATATTGATTCAAGGCCGTCTCTATATCTCTGAAAATCACATAT
GCTTCCATGCCAATATATTCGGCTGGATCACTAATGTAAGTCTCTCAGAGCCTTCTGGTTTCCTTTTAGACTCAT
CGAACCTCTAGATGTCGATCCCAATGTGCGAAGTCACTCAGCTCGATAAGCGCATGACCGCCTTCGTGATCCCCA
ACGCCATCCAGGCCACAACGCGGCAAGCTAAATATACTTTCGCTTCCTTCCTCTCCCGCGATACGACCTACGACG
TGATTTATAATATCTGGAGACTGGCTAAACCTGACGACGCCATCAATAGCAGTCGCCCCTCTTTTGACGGCGCCT
CAGTCGTCGAGTCAAATCCGATCCAGGGCAACGGGGAGGGGGCTTTGCTGAGAGCCCCTAAAATCACGACCTGTG
CATGTGCAGAGGGTGGTCATTACCACGAAACAGCGATGGATTGTGTGCTGCCTGGCACCCCTGATCGGATACATA
ATTTAATCTTTGCTAGTGCATTCATCAAAGAGTTCATGACTGTCGATCAAAAGCTAACCGGTGCGTAGCCATCCA
TTTGATGTTGTTCCCTGTTGCTCAACAATCTTTACAGACATTCAAATTTCGGATTGGCAACCTACCGAGCCGGGT
TCTGCTCTTCTTACTCGAAATATGTCTTATATCAAGCCCCTGCATGGCAGCGTCGGACCGAGATCTACCAAGTGC
GAAATTACCGACCTTATGGTTTACAAAGACTCCGAACATTACATTTCGACTGATACAACAACGCGGACACCAGAT
GTACCTAGCGGTGGCGTATTTTCTGTAAAGACGAAAACGTGTTTGACATGGGCAAGCTCTTTATCGACGAGGATA
GTTGTAACGACCGAGGTGCAATGGACTGGTCGTAGTTTCATCAAATGTGTGTCTTGCCACCTCTGTGAGATAAGG
TTGCTGACACGTTACTAGCCATCATCGAAAAGTCAGCCATCGAAGGGCAAAAGACGTGGCACAGGGACTTGGAAA
TTGCCATGCGAGCTTACATCCAAGAACATCAAGCCGAGTTCGTACCCGAAGGTGTCGATGCGTCTGCTCTTCCAG
CTTCGCCCAATCCAAACGTTCCGCCTACACCAGGAGAGGTGACAATATCATCGAAAGAAGCAAATAAACGACGGG
AACATGAAAGAAATCGACGTGGTTTACAATGGGCTTGGGATACATTTGAAGGTGCTTCGCAAGTCGCTATACGGA
GTACGAAAGACGCGTTTGAACTTGTTTGTGATGCTTGGGAACAATCGTCAAGTACGACCATAATGTGGTTTGTGA
TTGTCGGTCTTGTCTTGAGCAATCTATGGTCGTTGTTTTTGATGGGGTCGAGAGAAGAAGCTGGAAGGAGGAAAG
AGATGAAAAAGATGGAAGAGAGAGAGAAATGGGTACAAGGTGTTGTTAGAGCTTTATGGGATGAACTCTCAAAAC
AACAACCGCATAAAGAGCATTTATCGATGCCGTCGGATGGGATTTCTTGGGTTGCGGGTCTGGCGCAATCGCAAC
CTGTGCCTGCTGCGACGTGGAGTAGGGAGGTGGAGGATATGCAGGGTGTTTTGGATCAGTTGGAGGAGAGGATTA
AACTTTTGAATGAGGGTTTGAAGGTGATTAGGACGGAGGGGGGAGGGATTGATTCATTAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail