Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|002180
Gene name
Locationscaffold_1:547334..549206
Strand-
Gene length (bp)1872
Transcript length (bp)1212
Coding sequence length (bp)1212
Protein length (aa) 404

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00092 VWA von Willebrand factor type A domain 5.3E-09 164 317

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|002180
MAAFNLTETIYGVDRKPRSIQQWEEISYSNTQKVTQMGCQSPVAWVLIHGKNIPPNAIVAGEDKRRPLYIARTFW
EGGVRIGEAGSHFEKGASFAYNGKEIHVETYEVLVPLQQTVKYHIAGNYSIPSIPRISQAAPMRPPLTTDGSSDY
QTAQLVQKLRAVKVVMVIDDSISMAGSLWRQARLALTGLVSTIETDFNANGIDLCFLNNPTFESNIKSHHRVESL
FDSVRPEGSTPTGSKLQELFNLYLPLVEDPMRGTPPTVIMVITDGVPTDTVDKVIVDAARRLDDNNVPLRRFGVS
FVQIGDDPDAAEYLKELDDDIGTKFTCRDMVDTTPYDPAIPELTREAFIKCVLGSIDPYYDQARSPAELFRPQSQ
NSYYQPRPSPGYPMPPSFAHAPMMPRAN*
Coding >AgabiH97|002180
ATGGCTGCATTCAACCTCACCGAGACGATTTACGGAGTTGACAGGAAGCCACGCTCCATTCAACAATGGGAGGAG
ATATCCTACTCAAACACCCAGAAGGTTACCCAGATGGGATGCCAGTCGCCTGTGGCATGGGTTCTCATCCACGGC
AAGAACATACCTCCCAACGCTATCGTAGCCGGCGAGGATAAGAGGCGACCTTTATATATCGCCAGGACTTTTTGG
GAGGGTGGAGTCCGTATCGGGGAAGCTGGATCACATTTCGAAAAGGGCGCTTCATTTGCCTACAACGGCAAAGAA
ATACACGTTGAAACTTATGAAGTTTTGGTTCCGCTCCAACAAACCGTCAAATATCACATTGCTGGAAATTATAGC
ATCCCTAGCATCCCTCGTATTTCTCAAGCTGCTCCCATGCGGCCTCCTCTAACCACCGATGGATCATCTGATTAT
CAAACCGCTCAACTCGTACAGAAATTGCGGGCTGTCAAAGTTGTAATGGTTATTGACGATTCTATTTCGATGGCC
GGTAGCCTTTGGCGCCAAGCTCGATTGGCACTGACCGGACTTGTCTCTACCATCGAAACCGATTTCAATGCCAAC
GGGATTGATCTCTGCTTCCTGAACAATCCTACATTCGAGAGTAACATCAAAAGTCATCACAGGGTTGAGAGTCTT
TTCGATAGTGTCCGTCCAGAAGGATCAACACCCACTGGCTCTAAACTCCAAGAGCTTTTCAATTTGTATCTCCCC
TTGGTCGAGGATCCGATGAGAGGCACTCCTCCAACCGTCATAATGGTCATTACGGACGGCGTTCCAACCGATACA
GTGGACAAAGTTATTGTCGATGCCGCTCGTCGCCTAGATGATAACAATGTTCCGCTCCGCCGCTTCGGGGTGTCA
TTCGTTCAGATTGGCGACGACCCAGATGCTGCTGAATATTTGAAGGAGTTGGATGATGATATCGGCACTAAATTT
ACCTGCAGAGACATGGTTGACACTACGCCTTATGATCCGGCCATACCAGAGCTTACTCGAGAAGCCTTCATCAAA
TGTGTCCTGGGATCCATCGATCCTTACTACGATCAGGCTCGCAGCCCGGCTGAGTTATTCCGTCCTCAATCGCAA
AACAGTTACTATCAGCCACGACCATCCCCTGGTTACCCCATGCCACCGTCGTTTGCACATGCCCCGATGATGCCC
CGAGCGAATTAG
Transcript >AgabiH97|002180
ATGGCTGCATTCAACCTCACCGAGACGATTTACGGAGTTGACAGGAAGCCACGCTCCATTCAACAATGGGAGGAG
ATATCCTACTCAAACACCCAGAAGGTTACCCAGATGGGATGCCAGTCGCCTGTGGCATGGGTTCTCATCCACGGC
AAGAACATACCTCCCAACGCTATCGTAGCCGGCGAGGATAAGAGGCGACCTTTATATATCGCCAGGACTTTTTGG
GAGGGTGGAGTCCGTATCGGGGAAGCTGGATCACATTTCGAAAAGGGCGCTTCATTTGCCTACAACGGCAAAGAA
ATACACGTTGAAACTTATGAAGTTTTGGTTCCGCTCCAACAAACCGTCAAATATCACATTGCTGGAAATTATAGC
ATCCCTAGCATCCCTCGTATTTCTCAAGCTGCTCCCATGCGGCCTCCTCTAACCACCGATGGATCATCTGATTAT
CAAACCGCTCAACTCGTACAGAAATTGCGGGCTGTCAAAGTTGTAATGGTTATTGACGATTCTATTTCGATGGCC
GGTAGCCTTTGGCGCCAAGCTCGATTGGCACTGACCGGACTTGTCTCTACCATCGAAACCGATTTCAATGCCAAC
GGGATTGATCTCTGCTTCCTGAACAATCCTACATTCGAGAGTAACATCAAAAGTCATCACAGGGTTGAGAGTCTT
TTCGATAGTGTCCGTCCAGAAGGATCAACACCCACTGGCTCTAAACTCCAAGAGCTTTTCAATTTGTATCTCCCC
TTGGTCGAGGATCCGATGAGAGGCACTCCTCCAACCGTCATAATGGTCATTACGGACGGCGTTCCAACCGATACA
GTGGACAAAGTTATTGTCGATGCCGCTCGTCGCCTAGATGATAACAATGTTCCGCTCCGCCGCTTCGGGGTGTCA
TTCGTTCAGATTGGCGACGACCCAGATGCTGCTGAATATTTGAAGGAGTTGGATGATGATATCGGCACTAAATTT
ACCTGCAGAGACATGGTTGACACTACGCCTTATGATCCGGCCATACCAGAGCTTACTCGAGAAGCCTTCATCAAA
TGTGTCCTGGGATCCATCGATCCTTACTACGATCAGGCTCGCAGCCCGGCTGAGTTATTCCGTCCTCAATCGCAA
AACAGTTACTATCAGCCACGACCATCCCCTGGTTACCCCATGCCACCGTCGTTTGCACATGCCCCGATGATGCCC
CGAGCGAATTAG
Gene >AgabiH97|002180
ATGGCTGCATTCAACCTCACCGAGACGATTTACGGAGTTGACAGGAAGCCACGCTCCATTCAACAATGGGAGGAG
ATATCCTACTCAAACACCCAGAAGGTTACCCAGATGGGATGCCAGTCGCCTGTGGCATGGGTTAGTCGAAGCGGT
TGTCAACTGTGCAAGAACACTCATATGTCTTTGAAGGTTCTCATCCACGGCAAGAACATACCTCCCAACGCTATC
GTAGCCGGCGAGGATAAGAGGCGACCTTTATATATCGCCAGGACTTTTTGGGAGGTAGGCAAATCTCTTATTCAT
GATACGTCGGATGCTCACCAGTAACCTTGCGGATGTCAAGGGTGGAGTCCGTAAGTTATCCATCAGTGGGGCGCA
TGATTTCAGGCCTGACTGACGACTCCCGCTCTTTTCAGGTATCGGGGAAGCTGGATCACATTTCGAAAAGGGCGC
TTCATTTGCCTACAACGGCAAAGAAATACACGTAAGTACGAGAAACTCGAACAACGATCGAAGGGTTTGACTCAA
CGATACGGGGTGTTCAGGTTGAAACTTATGAAGTTTTGGTTCCGCTCCAACAAACCGTCAAATATCACATTGCTG
GAAATTATAGCATCCCTAGCATCCCTCGTATTTCTCAAGCTGCTCCCATGCGGCCTCCTCTAACCACCGATGGAT
CATCTGATTATCAAACCGCTCAACTCGTACAGAAATTGCGGTGGGTTTCGCCTCCTTTCACGAAGATAGTGGACA
TTTACTGACGCGCCATTGTTTTTTTTTTTTCTTAAAAAAAAAATAGGGCTGTCAAAGTTGTAATGGTTATTGACG
ATTCTATTTCGGTAAAGATGATTTATTTCATATGAAGCAACGAGCCCTCTAAGTCGTAAACATTCATAGATGGCC
GGTAGCCTTTGGCGCCAAGCTCGATTGGTGAGCGTTTTGACGCATAAAGAAGGGCTACACCAACACTCATCGTTC
AAAAGGCACTGACCGGACTTGTCTCTACCATCGAAACCGATTTCAATGCCAACGGGATTGATCTCTGCTTCCTGA
ACAATCCTACATTCGAGAGTAACATCAAAGTGAGAATGACATAATTGCGTTGATTGATCAGAGGCGGTATGAACA
TCTTTATAGAGTCATCACAGGGTTGAGAGTCTTTTCGATAGTGTCCGTCCAGAAGGTAGGCCCGAGGCGGGTGGC
GAATAACCGTGGTGGTGTTTTGATTTGACAATTGTTCCAGGATCAACACCCACTGGCTCTAAACTCCAAGAGCTT
TTCAATTTGTATCTCCCCTTGGTCGAGGATCCGATGAGAGGCACTCCTCCAACCGTCATAATGGTCATTACGGAC
GGCGTTCCAAGTAAGCAGCTTGAAATTTCAGATTGAATCAAGAATTTGACAATTTATACGTCTAGCCGATACAGT
GGACAAAGTTATTGTCGATGCCGCTCGTCGCCTAGATGATAACAATGTTCCGCTCCGCCGCTTCGGGGTGTCATT
CGTTCAGATTGGCGACGACCCAGATGCTGCTGAATATTTGAAGGAGTTGGATGATGATATCGGCACTAAATTTAC
CTGCAGAGTAAGTGTAGTCTCGCATCTGTCAATAATCACCCAGCCATCCTGACACGTGGGGACTATCAGGACATG
GTTGACACTACGCCTTATGATCCGGCCATACCAGAGCTTACTCGAGAAGCCTTCATCAAATGTGTCCTGGGATCC
ATCGATCCTTACTACGATCAGGCTCGCAGCCCGGCTGAGTTATTCCGTCCTCAATCGCAAAACAGTTACTATCAG
CCACGACCATCCCCTGGTTACCCCATGCCACCGTCGTTTGCACATGCCCCGATGATGCCCCGAGCGAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail