Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|001910
Gene name
Locationscaffold_1:480137..480893
Strand-
Gene length (bp)756
Transcript length (bp)600
Coding sequence length (bp)600
Protein length (aa) 200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02469 Fasciclin Fasciclin domain 2.2E-09 54 198

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5BD53|YFAS1_EMENI FAS1 domain-containing protein AN1527 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1527 PE=3 SV=2 39 197 5.0E-07
sp|Q4WC84|YFAS1_ASPFU FAS1 domain-containing protein AFUA_8G05360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_8G05360 PE=3 SV=1 40 131 6.0E-07
sp|Q9Y801|YFAS1_SCHPO FAS1 domain-containing protein mug57 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug57 PE=1 SV=2 1 197 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|001910
MKLHCLSLFLLSALSFVSASTTEQVIMASISDDFIPKKHDRPSLADLLTIEPSASIFYSYAREIALSRILDDTSQ
KYTLFVPTNKAVMALSRKPHQGPAHDHNGDDVKITEAQYDKQSKENVEQWISAHIISGFHMDFNSKEYQTLLDNK
TISVQPIPKNDGKGPAWTRVTLDGKKHIKSMKEASNGILYLLDGVISPW*
Coding >AgabiH97|001910
ATGAAGCTCCACTGCCTCTCACTCTTCCTCCTCTCTGCCCTGTCTTTTGTATCAGCCTCAACAACTGAACAGGTC
ATCATGGCATCCATTAGCGACGACTTTATTCCCAAGAAGCATGACCGACCGTCCTTGGCAGACCTCCTGACCATC
GAACCTTCTGCCTCCATCTTCTACTCTTATGCTCGCGAAATCGCGCTCAGCAGGATCTTGGATGACACAAGTCAA
AAGTACACCCTTTTCGTGCCCACGAATAAGGCTGTTATGGCACTGTCGCGGAAACCTCATCAAGGACCTGCTCAT
GATCACAACGGCGATGATGTTAAAATCACAGAAGCACAGTATGATAAGCAGTCAAAGGAGAACGTTGAGCAATGG
ATATCAGCCCACATTATCTCGGGTTTCCACATGGATTTCAATTCAAAGGAGTATCAAACTTTGTTGGATAACAAG
ACTATCTCTGTCCAGCCTATTCCTAAGAATGATGGCAAGGGACCGGCATGGACTCGGGTCACACTCGATGGCAAG
AAGCATATAAAATCGATGAAAGAGGCTTCAAATGGTATACTATATCTACTTGATGGTGTCATCTCACCATGGTAG
Transcript >AgabiH97|001910
ATGAAGCTCCACTGCCTCTCACTCTTCCTCCTCTCTGCCCTGTCTTTTGTATCAGCCTCAACAACTGAACAGGTC
ATCATGGCATCCATTAGCGACGACTTTATTCCCAAGAAGCATGACCGACCGTCCTTGGCAGACCTCCTGACCATC
GAACCTTCTGCCTCCATCTTCTACTCTTATGCTCGCGAAATCGCGCTCAGCAGGATCTTGGATGACACAAGTCAA
AAGTACACCCTTTTCGTGCCCACGAATAAGGCTGTTATGGCACTGTCGCGGAAACCTCATCAAGGACCTGCTCAT
GATCACAACGGCGATGATGTTAAAATCACAGAAGCACAGTATGATAAGCAGTCAAAGGAGAACGTTGAGCAATGG
ATATCAGCCCACATTATCTCGGGTTTCCACATGGATTTCAATTCAAAGGAGTATCAAACTTTGTTGGATAACAAG
ACTATCTCTGTCCAGCCTATTCCTAAGAATGATGGCAAGGGACCGGCATGGACTCGGGTCACACTCGATGGCAAG
AAGCATATAAAATCGATGAAAGAGGCTTCAAATGGTATACTATATCTACTTGATGGTGTCATCTCACCATGGTAG
Gene >AgabiH97|001910
ATGAAGCTCCACTGCCTCTCACTCTTCCTCCTCTCTGCCCTGTCTTTTGTATCAGCCTCAACAACTGAACAGGTC
ATCATGGCATCCATTAGCGACGACTTTATTCCCAAGAAGCATGACCGACCGTCCTTGGCAGACCTCCTGACCATC
GAACCTTCTGCCTCCATCTTCTACTCTTATGCTCGCGAAATCGCGCTCAGCAGGATCTTGGATGACACAAGTCAA
AAGTACACCCTTTTCGTGCCCACGAATAAGGCTGTTATGGCACTGTCGCGGAAACCGTGCGTCTACTCAGATATG
TTTCTTCATGGTGACGTCTGACACTTCTGCAGTCATCAAGGACCTGCTCATGATCACAACGGCGATGATGTTAAA
ATCACAGAAGCACAGTATGATAAGCAGTCAAAGGAGAACGTTGAGCAATGGATATCAGCCCACATTATCTCGGCA
TGTCAAAGTCTCCTCCATTCTAAGTCGATCCGCTTCTAATCTCCATTTTATAGGGTTTCCACATGGATTTCAATT
CAAAGGAGTATCAAACTTTGTTGGATAACAAGACTATCTCTGTCCAGCCTATTCCTAAGAATGATGGCAAGGGAC
CGGCATGGACTCGGGTCACACTCGATGGCAAGAAGCATATAAAATCGATGAAAGAGGTAAGCCTGCATTTTCCCT
GTTCGATAGTCCATTCTCAATGTCGAATAGGCTTCAAATGGTATACTATATCTACTTGATGGTGTCATCTCACCA
TGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail