Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|001890
Gene name
Locationscaffold_1:477853..478405
Strand-
Gene length (bp)552
Transcript length (bp)387
Coding sequence length (bp)387
Protein length (aa) 129

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03330 DPBB_1 Lytic transglycolase 7.2E-08 29 125

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 30 128 2.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|001890
MVLTKNLLALSLSALLVGSYSVLRVAARAGKASYYETGISACGRIISDTELITALNPDDFADFQNCGRTIEVNYE
GRSIRVEMADECPECDPDIDVGFGVTMDLSRAAFELLTGDLSKGIIPIEWEYV*
Coding >AgabiH97|001890
ATGGTTTTAACCAAAAATCTACTCGCACTTTCCCTTTCCGCCTTGCTGGTGGGAAGTTATAGTGTTCTCCGAGTC
GCCGCTCGTGCCGGGAAGGCGTCTTATTATGAAACTGGTATATCGGCGTGTGGCCGCATTATTTCTGATACGGAA
CTGATAACCGCTCTGAATCCGGACGATTTCGCTGATTTTCAAAATTGCGGTCGCACCATCGAAGTTAATTATGAA
GGGCGCTCTATTAGGGTTGAAATGGCTGACGAATGTCCGGAATGCGATCCGGATATCGATGTTGGATTCGGCGTC
ACGATGGATTTATCTCGGGCAGCTTTTGAATTGCTTACTGGCGATTTGTCAAAGGGAATTATTCCGATAGAATGG
GAATATGTCTAG
Transcript >AgabiH97|001890
ATGGTTTTAACCAAAAATCTACTCGCACTTTCCCTTTCCGCCTTGCTGGTGGGAAGTTATAGTGTTCTCCGAGTC
GCCGCTCGTGCCGGGAAGGCGTCTTATTATGAAACTGGTATATCGGCGTGTGGCCGCATTATTTCTGATACGGAA
CTGATAACCGCTCTGAATCCGGACGATTTCGCTGATTTTCAAAATTGCGGTCGCACCATCGAAGTTAATTATGAA
GGGCGCTCTATTAGGGTTGAAATGGCTGACGAATGTCCGGAATGCGATCCGGATATCGATGTTGGATTCGGCGTC
ACGATGGATTTATCTCGGGCAGCTTTTGAATTGCTTACTGGCGATTTGTCAAAGGGAATTATTCCGATAGAATGG
GAATATGTCTAG
Gene >AgabiH97|001890
ATGGTTTTAACCAAAAATCTACTCGCACTTTCCCTTTCCGCCTTGCTGGTGGGAAGTTATAGTGTTCTCCGAGTC
GCCGCTCGTGCCGGGAAGGGTAAGCCTTCAATGCAAACTCCAAGTTGTTGAGCGTCTTTAGTAATTTATCGTGCA
GCGTCTTATTATGAAACTGGTGTAGGTTTACGTAGTGTGTTGTCTTGCTCCTAGTTTCACAACGTTCTATTCCTT
AGATATCGGCGTGTGGCCGCATTATTTCTGATACGGAACTGATAACCGCTCTGAATCCGGACGATTTCGCTGATT
TTCAAAATTGCGGTCGCACCATCGAAGTTAATTGTAGGTTAACAGTGTATTATTATGAAATTGAATCTAACAGCG
GTTGTTGTAGATGAAGGGCGCTCTATTAGGGTTGAAATGGCTGACGAATGTCCGGAATGCGATCCGGATATCGAT
GTTGGATTCGGCGTCACGATGGATTTATCTCGGGCAGCTTTTGAATTGCTTACTGGCGATTTGTCAAAGGGAATT
ATTCCGATAGAATGGGAATATGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail