Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|001350
Gene name
Locationscaffold_1:315452..317051
Strand+
Gene length (bp)1599
Transcript length (bp)1263
Coding sequence length (bp)1263
Protein length (aa) 421

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09451 ATG27 Autophagy-related protein 27 1.3E-09 70 247
PF00878 CIMR Cation-independent mannose-6-phosphate receptor repeat 3.1E-05 125 173

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005537 mannose binding Yes
GO:0038023 signaling receptor activity Yes
GO:0007041 lysosomal transport Yes
GO:0046907 intracellular transport No
GO:0030246 carbohydrate binding No
GO:0007034 vacuolar transport No
GO:0006810 transport No
GO:0036094 small molecule binding No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0060089 molecular transducer activity No
GO:0005488 binding No
GO:0051641 cellular localization No
GO:0003674 molecular_function No
GO:0048029 monosaccharide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 184 206 22
2 394 413 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 57.04 33.72 80.35
Initials Initials knots 59.40 35.41 83.40
Pileal_Stipeal_center Stage I stipe center 69.25 41.35 97.14
Pileal_Stipeal_shell Stage I stipe shell 54.60 32.50 76.71
DIF_stipe_center Stage II stipe center 57.88 34.52 81.23
DIF_stipe_shell Stage II stipe shell 68.73 41.19 96.27
DIF_stipe_skin Stage II stipe skin 71.03 42.61 99.46
DIF_cap_skin Stage II cap skin 56.07 33.40 78.74
DIF_cap_tissue Stage II cap tissue 54.59 32.46 76.73
DIF_gill_tissue Stage II gill tissue 52.94 31.43 74.45
YFB_stipe_center Young fruiting body stipe center 52.80 31.26 74.34
YFB_stipe_shell Young fruiting body stipe shell 58.41 34.84 81.97
YFB_stipe_skin Young fruiting body stipe skin 63.49 37.79 89.20
YFB_cap_skin Young fruiting body cap skin 62.22 37.07 87.37
YFB_cap_tissue Young fruiting body cap tissue 61.66 36.72 86.59
YFB_gill_tissue Young fruiting body gill tissue 58.68 34.98 82.38
YFB_veil Young fruiting body veil 54.47 32.31 76.63

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.881514 no
Casing YFB_stipe_center 0.878407 no
Casing YFB_stipe_shell 0.965367 no
Casing YFB_stipe_skin 0.812796 no
Casing YFB_cap_skin 0.858297 no
Casing YFB_cap_tissue 0.875473 no
Casing YFB_gill_tissue 0.958652 no
Casing YFB_veil 0.931559 no
Casing Initials 0.939583 no
Casing Pileal_Stipeal_center 0.612292 no
Casing Pileal_Stipeal_shell 0.934109 no
Casing DIF_stipe_center 0.978545 no
Casing DIF_stipe_shell 0.621927 no
Casing DIF_stipe_skin 0.536499 no
Casing DIF_cap_skin 0.975571 no
Casing DIF_cap_tissue 0.935100 no
DIF_gill_tissue YFB_stipe_center 0.995372 no
DIF_gill_tissue YFB_stipe_shell 0.833278 no
DIF_gill_tissue YFB_stipe_skin 0.640499 no
DIF_gill_tissue YFB_cap_skin 0.686282 no
DIF_gill_tissue YFB_cap_tissue 0.711339 no
DIF_gill_tissue YFB_gill_tissue 0.825538 no
DIF_gill_tissue YFB_veil 0.957984 no
YFB_stipe_center YFB_stipe_shell 0.828424 no
YFB_stipe_center YFB_stipe_skin 0.636908 no
YFB_stipe_center YFB_cap_skin 0.682436 no
YFB_stipe_center YFB_cap_tissue 0.706133 no
YFB_stipe_center YFB_gill_tissue 0.821119 no
YFB_stipe_center YFB_veil 0.955405 no
YFB_stipe_shell YFB_stipe_skin 0.863868 no
YFB_stipe_shell YFB_cap_skin 0.903299 no
YFB_stipe_shell YFB_cap_tissue 0.919193 no
YFB_stipe_shell YFB_gill_tissue 0.993235 no
YFB_stipe_shell YFB_veil 0.890171 no
YFB_stipe_skin YFB_cap_skin 0.972168 no
YFB_stipe_skin YFB_cap_tissue 0.959159 no
YFB_stipe_skin YFB_gill_tissue 0.878078 no
YFB_stipe_skin YFB_veil 0.715110 no
YFB_cap_skin YFB_cap_tissue 0.986381 no
YFB_cap_skin YFB_gill_tissue 0.911334 no
YFB_cap_skin YFB_veil 0.758915 no
YFB_cap_tissue YFB_gill_tissue 0.928498 no
YFB_cap_tissue YFB_veil 0.783132 no
YFB_gill_tissue YFB_veil 0.882953 no
Initials DIF_gill_tissue 0.800492 no
Initials YFB_stipe_center 0.795785 no
Initials YFB_stipe_shell 0.975878 no
Initials YFB_stipe_skin 0.895917 no
Initials YFB_cap_skin 0.931620 no
Initials YFB_cap_tissue 0.946862 no
Initials YFB_gill_tissue 0.982439 no
Initials YFB_veil 0.859524 no
Initials Pileal_Stipeal_center 0.716595 no
Initials Pileal_Stipeal_shell 0.862130 no
Initials DIF_stipe_center 0.963506 no
Initials DIF_stipe_shell 0.726861 no
Initials DIF_stipe_skin 0.645257 no
Initials DIF_cap_skin 0.915014 no
Initials DIF_cap_tissue 0.863331 no
Pileal_Stipeal_center DIF_gill_tissue 0.421150 no
Pileal_Stipeal_center YFB_stipe_center 0.417331 no
Pileal_Stipeal_center YFB_stipe_shell 0.668900 no
Pileal_Stipeal_center YFB_stipe_skin 0.855782 no
Pileal_Stipeal_center YFB_cap_skin 0.816391 no
Pileal_Stipeal_center YFB_cap_tissue 0.797542 no
Pileal_Stipeal_center YFB_gill_tissue 0.684435 no
Pileal_Stipeal_center YFB_veil 0.495303 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.500733 no
Pileal_Stipeal_center DIF_stipe_center 0.648034 no
Pileal_Stipeal_center DIF_stipe_shell 0.988880 no
Pileal_Stipeal_center DIF_stipe_skin 0.962574 no
Pileal_Stipeal_center DIF_cap_skin 0.572746 no
Pileal_Stipeal_center DIF_cap_tissue 0.501473 no
Pileal_Stipeal_shell DIF_gill_tissue 0.953717 no
Pileal_Stipeal_shell YFB_stipe_center 0.950430 no
Pileal_Stipeal_shell YFB_stipe_shell 0.894814 no
Pileal_Stipeal_shell YFB_stipe_skin 0.718881 no
Pileal_Stipeal_shell YFB_cap_skin 0.765997 no
Pileal_Stipeal_shell YFB_cap_tissue 0.786418 no
Pileal_Stipeal_shell YFB_gill_tissue 0.888319 no
Pileal_Stipeal_shell YFB_veil 0.996056 no
Pileal_Stipeal_shell DIF_stipe_center 0.911894 no
Pileal_Stipeal_shell DIF_stipe_shell 0.515125 no
Pileal_Stipeal_shell DIF_stipe_skin 0.437591 no
Pileal_Stipeal_shell DIF_cap_skin 0.962135 no
Pileal_Stipeal_shell DIF_cap_tissue 0.999643 no
DIF_stipe_center DIF_gill_tissue 0.853437 no
DIF_stipe_center YFB_stipe_center 0.849818 no
DIF_stipe_center YFB_stipe_shell 0.986251 no
DIF_stipe_center YFB_stipe_skin 0.844618 no
DIF_stipe_center YFB_cap_skin 0.885478 no
DIF_stipe_center YFB_cap_tissue 0.902927 no
DIF_stipe_center YFB_gill_tissue 0.980421 no
DIF_stipe_center YFB_veil 0.906654 no
DIF_stipe_center DIF_stipe_shell 0.659443 no
DIF_stipe_center DIF_stipe_skin 0.577094 no
DIF_stipe_center DIF_cap_skin 0.955853 no
DIF_stipe_center DIF_cap_tissue 0.911042 no
DIF_stipe_shell DIF_gill_tissue 0.427277 no
DIF_stipe_shell YFB_stipe_center 0.424144 no
DIF_stipe_shell YFB_stipe_shell 0.681549 no
DIF_stipe_shell YFB_stipe_skin 0.868329 no
DIF_stipe_shell YFB_cap_skin 0.828081 no
DIF_stipe_shell YFB_cap_tissue 0.810925 no
DIF_stipe_shell YFB_gill_tissue 0.696947 no
DIF_stipe_shell YFB_veil 0.503895 no
DIF_stipe_shell DIF_stipe_skin 0.950908 no
DIF_stipe_shell DIF_cap_skin 0.581181 no
DIF_stipe_shell DIF_cap_tissue 0.509529 no
DIF_stipe_skin DIF_gill_tissue 0.353026 no
DIF_stipe_skin YFB_stipe_center 0.350907 no
DIF_stipe_skin YFB_stipe_shell 0.597707 no
DIF_stipe_skin YFB_stipe_skin 0.799856 no
DIF_stipe_skin YFB_cap_skin 0.756333 no
DIF_stipe_skin YFB_cap_tissue 0.735060 no
DIF_stipe_skin YFB_gill_tissue 0.614230 no
DIF_stipe_skin YFB_veil 0.421621 no
DIF_stipe_skin DIF_cap_skin 0.498492 no
DIF_stipe_skin DIF_cap_tissue 0.425028 no
DIF_cap_skin DIF_gill_tissue 0.911254 no
DIF_cap_skin YFB_stipe_center 0.908427 no
DIF_cap_skin YFB_stipe_shell 0.939905 no
DIF_cap_skin YFB_stipe_skin 0.777315 no
DIF_cap_skin YFB_cap_skin 0.822795 no
DIF_cap_skin YFB_cap_tissue 0.843211 no
DIF_cap_skin YFB_gill_tissue 0.932351 no
DIF_cap_skin YFB_veil 0.956969 no
DIF_cap_skin DIF_cap_tissue 0.961125 no
DIF_cap_tissue DIF_gill_tissue 0.953972 no
DIF_cap_tissue YFB_stipe_center 0.950933 no
DIF_cap_tissue YFB_stipe_shell 0.894431 no
DIF_cap_tissue YFB_stipe_skin 0.717483 no
DIF_cap_tissue YFB_cap_skin 0.764664 no
DIF_cap_tissue YFB_cap_tissue 0.785227 no
DIF_cap_tissue YFB_gill_tissue 0.888290 no
DIF_cap_tissue YFB_veil 0.996158 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|001350
MRIVQHLPLLALAGVVLADDKPCTAYADGKYYDLNNLKGRPDSELKTPGGHDLKFNVCQGVTTELYGLKEDIKAE
NVAGFVRKGHGDFAIGQVKTTLSVVESRPRLVFSDGSNCKASPDGASLGMKASTIVEFICDTSVFGAGKPRLVGQ
LPPGDDEVGCSYFIEWKTNFACPTSAGGGGFWGFLGMLAIVTLILLMTYTALGTLYNRYVLQLRGFDQIPQFSVE
SMKYHAREATDWIKDILAAYNTGGNGGGYVPGRSAAANPFSHQTQANEELNINNNFVRPQATTIRSQPDTNPVSH
HTQSQAETQSTHNSPPPLPPKRSLPQIAPRRVALGSRGPTKEEQDFLLGEEEEEEGQELEDKPSSKSSVPPPLPT
NVDSSTPARIRCGYDDGGFATLPCYLVLYPGLISHYLWKSMRPLF*
Coding >AgabiH97|001350
ATGCGCATCGTGCAGCATCTACCCCTCCTCGCCCTTGCCGGCGTAGTTCTTGCCGACGACAAGCCATGCACAGCC
TACGCTGACGGGAAATACTACGACCTCAACAATCTCAAAGGACGGCCGGACTCTGAACTCAAGACCCCAGGCGGA
CACGATCTCAAGTTCAACGTCTGCCAGGGCGTAACTACTGAGCTTTATGGTCTCAAGGAGGATATCAAAGCAGAA
AATGTCGCTGGTTTCGTCCGTAAAGGTCATGGAGACTTTGCGATTGGTCAGGTCAAAACCACACTCTCAGTCGTG
GAATCTAGGCCCCGCCTTGTATTTTCTGATGGATCAAATTGCAAGGCGTCCCCAGACGGAGCCAGCCTTGGCATG
AAAGCTTCTACTATCGTCGAATTTATCTGTGATACCTCTGTGTTCGGCGCGGGGAAGCCCCGTCTCGTAGGTCAA
CTACCCCCTGGAGACGATGAAGTTGGCTGCTCCTACTTCATTGAGTGGAAGACCAACTTTGCATGTCCGACGTCC
GCAGGCGGCGGCGGGTTCTGGGGTTTTCTCGGCATGTTAGCCATTGTAACACTCATCCTTCTCATGACTTATACC
GCGTTGGGCACGTTGTATAATCGATATGTCCTACAACTTCGTGGCTTTGATCAAATACCTCAATTCTCTGTTGAG
AGCATGAAGTACCATGCACGCGAGGCTACAGATTGGATAAAGGATATCTTGGCTGCGTACAACACCGGTGGAAAC
GGAGGAGGATATGTTCCTGGAAGATCTGCGGCAGCCAACCCTTTCAGCCATCAAACTCAGGCAAATGAAGAACTC
AACATCAATAATAACTTTGTTCGTCCCCAGGCAACTACTATCCGTTCACAACCCGATACCAATCCTGTATCCCAC
CATACTCAATCACAAGCCGAGACACAGTCGACACATAACTCGCCCCCACCTTTACCCCCCAAGCGATCACTTCCT
CAAATTGCACCTCGGCGTGTAGCACTGGGCAGCCGAGGGCCAACAAAAGAGGAACAGGACTTCTTACTTGGAGAA
GAGGAAGAAGAGGAAGGCCAGGAATTAGAAGACAAACCCAGTTCAAAGTCTTCTGTCCCACCACCACTGCCAACT
AATGTCGATTCCTCGACTCCGGCGAGGATTCGCTGCGGCTATGATGATGGGGGCTTCGCTACATTACCTTGCTAT
CTTGTCCTGTACCCTGGGTTGATCTCTCATTATCTGTGGAAATCAATGAGACCATTGTTCTAG
Transcript >AgabiH97|001350
ATGCGCATCGTGCAGCATCTACCCCTCCTCGCCCTTGCCGGCGTAGTTCTTGCCGACGACAAGCCATGCACAGCC
TACGCTGACGGGAAATACTACGACCTCAACAATCTCAAAGGACGGCCGGACTCTGAACTCAAGACCCCAGGCGGA
CACGATCTCAAGTTCAACGTCTGCCAGGGCGTAACTACTGAGCTTTATGGTCTCAAGGAGGATATCAAAGCAGAA
AATGTCGCTGGTTTCGTCCGTAAAGGTCATGGAGACTTTGCGATTGGTCAGGTCAAAACCACACTCTCAGTCGTG
GAATCTAGGCCCCGCCTTGTATTTTCTGATGGATCAAATTGCAAGGCGTCCCCAGACGGAGCCAGCCTTGGCATG
AAAGCTTCTACTATCGTCGAATTTATCTGTGATACCTCTGTGTTCGGCGCGGGGAAGCCCCGTCTCGTAGGTCAA
CTACCCCCTGGAGACGATGAAGTTGGCTGCTCCTACTTCATTGAGTGGAAGACCAACTTTGCATGTCCGACGTCC
GCAGGCGGCGGCGGGTTCTGGGGTTTTCTCGGCATGTTAGCCATTGTAACACTCATCCTTCTCATGACTTATACC
GCGTTGGGCACGTTGTATAATCGATATGTCCTACAACTTCGTGGCTTTGATCAAATACCTCAATTCTCTGTTGAG
AGCATGAAGTACCATGCACGCGAGGCTACAGATTGGATAAAGGATATCTTGGCTGCGTACAACACCGGTGGAAAC
GGAGGAGGATATGTTCCTGGAAGATCTGCGGCAGCCAACCCTTTCAGCCATCAAACTCAGGCAAATGAAGAACTC
AACATCAATAATAACTTTGTTCGTCCCCAGGCAACTACTATCCGTTCACAACCCGATACCAATCCTGTATCCCAC
CATACTCAATCACAAGCCGAGACACAGTCGACACATAACTCGCCCCCACCTTTACCCCCCAAGCGATCACTTCCT
CAAATTGCACCTCGGCGTGTAGCACTGGGCAGCCGAGGGCCAACAAAAGAGGAACAGGACTTCTTACTTGGAGAA
GAGGAAGAAGAGGAAGGCCAGGAATTAGAAGACAAACCCAGTTCAAAGTCTTCTGTCCCACCACCACTGCCAACT
AATGTCGATTCCTCGACTCCGGCGAGGATTCGCTGCGGCTATGATGATGGGGGCTTCGCTACATTACCTTGCTAT
CTTGTCCTGTACCCTGGGTTGATCTCTCATTATCTGTGGAAATCAATGAGACCATTGTTCTAG
Gene >AgabiH97|001350
ATGCGCATCGTGCAGCATCTACCCCTCCTCGCCCTTGCCGGCGTAGTTCTTGCCGACGACAAGCCATGCACAGCC
TACGCTGACGGGAAATACTACGACCTCAACAATCTCAAAGGACGGTGAGGCGTCGTCGAGTGGTCGTCTGCATCG
TCTCTAAACAACTGTGTTGTCCAGGCCGGACTCTGAACTCAAGACCCCAGGCGGACACGATCTCAAGTTCAACGT
CTGCCAGGGCGTAACTACTGAGCTTTATGGTCTCAAGGAGGATATCAAAGCAGAAAATGTCGCTGGTTTCGTCCG
TAAAGGTCATGGAGACTTTGCGATTGGGTGGGTGCTGCGCATTGCCGACGTCACCGCGAACTAAGCATCCGGCCA
ATAGTCAGGTCAAAACCACACTCTCAGTCGTGGAATCTAGGCCCCGCCTTGTATTTTCTGATGGATCAAATTGCA
AGGCGTCCCCAGACGGAGCCAGCCTTGGCATGAAAGCTTCTACTATCGTCGAATTTATCTGTGATACCTCTGTGT
TCGGCGCGGGGAAGCCCCGTCTCGTAGGTCAACTACCCCCTGGAGACGATGAAGTTGGCTGCTCCTACTTCATTG
AGTGGAAGACCAACGTAAGGCAGCCCTTTCCTCCGGTACCGAACATGTTTCGCCTAACGGTCTGATAGTTTGCAT
GTCCGACGTCCGCAGGCGGCGGCGGGTTCTGGGGTTTTCTCGGCATGTTAGCCATTGTGTACACCACATCTCTTA
CTTTTCACTGTTTGTGACTTCAAGCTGACCCGCTGCCTAGAACACTCATCCTTCTCATGACTTATACCGCGTTGG
GCACGTTGTATAATCGATATGTCCTACAACTTCGTGGCTTTGATCAAATACCTCAATTCTCTGTTGAGAGCATGA
AGTACCATGCACGCGAGGCTACAGATTGGATAAAGGATATCTTGGCTGCGTACAACACCGGTGGAAACGGAGGAG
GATATGTTCCTGGAAGATCTGCGGCAGCCAACCCTTTCAGCCATCAAACTCAGGCAAATGAAGAACTCAACATCA
ATAATAACTTTGTTCGTCCCCAGGCAACTACTATCCGTTCACAACCCGATACCAATCCTGTATCCCACCATACTC
AATCACAAGCCGAGACACAGTCGACACATAACTCGCCCCCACCTTTACCCCCCAAGCGATCACTTCCTCAAATTG
CACCTCGGCGTGTAGCACTGGGCAGCCGAGGGCCAACAAAAGAGGAACAGGACTTCTTACTTGGAGAAGAGGAAG
AAGAGGAAGGCCAGGAATTAGAAGACAAACCCAGTTCAAAGTCTTCTGTCCCACCACCACTGCCAACTAATGTCG
ATTCCTCGACTCGTGGCTCTTCCAGCACATTGAATCGTGGAGACGTTAATGTAGCGTCTATTCGTGGTCAAGATA
GCGGCGAGGATTCGCTGCGGCTATGATGATGGGGGCTTCGCTACATTACCTTGCTATCTTGTCCTGTACCCTGGG
TTGATCTCTCATTATCGTATTTCCGCCTCACATGTTGGCTACTATTCTGAAACTGATTTAGTCTTTTCAGTGTGG
AAATCAATGAGACCATTGTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail