© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|001300 |
| Gene name | |
| Location | scaffold_1:302986..304489 |
| Strand | - |
| Gene length (bp) | 1503 |
| Transcript length (bp) | 840 |
| Coding sequence length (bp) | 840 |
| Protein length (aa) | 280 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00378 | ECH_1 | Enoyl-CoA hydratase/isomerase | 4.2E-59 | 21 | 275 |
| PF16113 | ECH_2 | Enoyl-CoA hydratase/isomerase | 1.1E-31 | 25 | 263 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q8GB17|CAID_PROSL | Carnitinyl-CoA dehydratase OS=Proteus sp. (strain LE138) GN=caiD PE=1 SV=3 | 23 | 274 | 3.0E-44 |
| sp|B4EY26|CAID_PROMH | Carnitinyl-CoA dehydratase OS=Proteus mirabilis (strain HI4320) GN=caiD PE=3 SV=1 | 23 | 274 | 3.0E-44 |
| sp|Q8XA35|CAID_ECO57 | Carnitinyl-CoA dehydratase OS=Escherichia coli O157:H7 GN=caiD PE=3 SV=3 | 23 | 274 | 9.0E-42 |
| sp|P52046|CRT_CLOAB | Short-chain-enoyl-CoA hydratase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=crt PE=1 SV=1 | 20 | 269 | 1.0E-41 |
| sp|Q8Z9L5|CAID_SALTI | Carnitinyl-CoA dehydratase OS=Salmonella typhi GN=caiD PE=3 SV=3 | 23 | 274 | 1.0E-41 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q8GB17|CAID_PROSL | Carnitinyl-CoA dehydratase OS=Proteus sp. (strain LE138) GN=caiD PE=1 SV=3 | 23 | 274 | 3.0E-44 |
| sp|B4EY26|CAID_PROMH | Carnitinyl-CoA dehydratase OS=Proteus mirabilis (strain HI4320) GN=caiD PE=3 SV=1 | 23 | 274 | 3.0E-44 |
| sp|Q8XA35|CAID_ECO57 | Carnitinyl-CoA dehydratase OS=Escherichia coli O157:H7 GN=caiD PE=3 SV=3 | 23 | 274 | 9.0E-42 |
| sp|P52046|CRT_CLOAB | Short-chain-enoyl-CoA hydratase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=crt PE=1 SV=1 | 20 | 269 | 1.0E-41 |
| sp|Q8Z9L5|CAID_SALTI | Carnitinyl-CoA dehydratase OS=Salmonella typhi GN=caiD PE=3 SV=3 | 23 | 274 | 1.0E-41 |
| sp|B4T6J5|CAID_SALNS | Carnitinyl-CoA dehydratase OS=Salmonella newport (strain SL254) GN=caiD PE=3 SV=1 | 23 | 274 | 2.0E-41 |
| sp|B1LFW9|CAID_ECOSM | Carnitinyl-CoA dehydratase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiD PE=3 SV=1 | 23 | 274 | 2.0E-41 |
| sp|P31551|CAID_ECOLI | Carnitinyl-CoA dehydratase OS=Escherichia coli (strain K12) GN=caiD PE=1 SV=4 | 23 | 274 | 2.0E-41 |
| sp|B1IRE0|CAID_ECOLC | Carnitinyl-CoA dehydratase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiD PE=3 SV=1 | 23 | 274 | 2.0E-41 |
| sp|P34559|ECHM_CAEEL | Probable enoyl-CoA hydratase, mitochondrial OS=Caenorhabditis elegans GN=ech-6 PE=3 SV=1 | 20 | 275 | 2.0E-41 |
| sp|P59395|CAID_SHIFL | Carnitinyl-CoA dehydratase OS=Shigella flexneri GN=caiD PE=3 SV=2 | 23 | 274 | 2.0E-41 |
| sp|Q8FLA6|CAID_ECOL6 | Carnitinyl-CoA dehydratase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiD PE=3 SV=3 | 23 | 274 | 2.0E-41 |
| sp|Q0TLV3|CAID_ECOL5 | Carnitinyl-CoA dehydratase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiD PE=3 SV=1 | 23 | 274 | 2.0E-41 |
| sp|P30084|ECHM_HUMAN | Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=ECHS1 PE=1 SV=4 | 21 | 275 | 3.0E-41 |
| sp|A8ALR7|CAID_CITK8 | Carnitinyl-CoA dehydratase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiD PE=3 SV=1 | 23 | 274 | 3.0E-41 |
| sp|B5BL54|CAID_SALPK | Carnitinyl-CoA dehydratase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiD PE=3 SV=1 | 23 | 274 | 1.0E-40 |
| sp|C0Q4L2|CAID_SALPC | Carnitinyl-CoA dehydratase OS=Salmonella paratyphi C (strain RKS4594) GN=caiD PE=3 SV=1 | 23 | 274 | 1.0E-40 |
| sp|Q5PIL1|CAID_SALPA | Carnitinyl-CoA dehydratase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiD PE=3 SV=1 | 23 | 274 | 1.0E-40 |
| sp|Q57TJ1|CAID_SALCH | Carnitinyl-CoA dehydratase OS=Salmonella choleraesuis (strain SC-B67) GN=caiD PE=3 SV=1 | 23 | 274 | 1.0E-40 |
| sp|B5F749|CAID_SALA4 | Carnitinyl-CoA dehydratase OS=Salmonella agona (strain SL483) GN=caiD PE=3 SV=1 | 23 | 274 | 1.0E-40 |
| sp|Q8ZRX5|CAID_SALTY | Carnitinyl-CoA dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiD PE=3 SV=3 | 23 | 274 | 1.0E-40 |
| sp|B4TWR3|CAID_SALSV | Carnitinyl-CoA dehydratase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiD PE=3 SV=1 | 23 | 274 | 1.0E-40 |
| sp|A9MYJ5|CAID_SALPB | Carnitinyl-CoA dehydratase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiD PE=3 SV=1 | 23 | 274 | 1.0E-40 |
| sp|B4TIG9|CAID_SALHS | Carnitinyl-CoA dehydratase OS=Salmonella heidelberg (strain SL476) GN=caiD PE=3 SV=1 | 23 | 274 | 1.0E-40 |
| sp|B5FHG4|CAID_SALDC | Carnitinyl-CoA dehydratase OS=Salmonella dublin (strain CT_02021853) GN=caiD PE=3 SV=1 | 23 | 274 | 1.0E-40 |
| sp|P76082|PAAF_ECOLI | 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) GN=paaF PE=1 SV=1 | 20 | 274 | 2.0E-40 |
| sp|Q5R646|ECHM_PONAB | Enoyl-CoA hydratase, mitochondrial OS=Pongo abelii GN=ECHS1 PE=2 SV=1 | 21 | 275 | 5.0E-40 |
| sp|Q1ZXF1|ECHM_DICDI | Probable enoyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=echs1 PE=3 SV=1 | 22 | 275 | 6.0E-40 |
| sp|B5RGA4|CAID_SALG2 | Carnitinyl-CoA dehydratase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=caiD PE=3 SV=1 | 23 | 274 | 1.0E-39 |
| sp|B5R1Q9|CAID_SALEP | Carnitinyl-CoA dehydratase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiD PE=3 SV=1 | 23 | 274 | 1.0E-39 |
| sp|A4YI89|HPCD_METS5 | 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_2001 PE=1 SV=1 | 20 | 274 | 2.0E-39 |
| sp|A9MR28|CAID_SALAR | Carnitinyl-CoA dehydratase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiD PE=3 SV=1 | 23 | 274 | 2.0E-39 |
| sp|O07137|ECHA8_MYCLE | Probable enoyl-CoA hydratase echA8 OS=Mycobacterium leprae (strain TN) GN=echA8 PE=3 SV=1 | 21 | 271 | 1.0E-38 |
| sp|Q8BH95|ECHM_MOUSE | Enoyl-CoA hydratase, mitochondrial OS=Mus musculus GN=Echs1 PE=1 SV=1 | 23 | 275 | 2.0E-38 |
| sp|P9WNN9|ECHA8_MYCTU | Probable enoyl-CoA hydratase echA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA8 PE=1 SV=1 | 20 | 271 | 4.0E-38 |
| sp|P9WNN8|ECHA8_MYCTO | Probable enoyl-CoA hydratase echA8 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA8 PE=3 SV=1 | 20 | 271 | 4.0E-38 |
| sp|P64017|ECHA8_MYCBO | Probable enoyl-CoA hydratase echA8 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA8 PE=3 SV=1 | 20 | 271 | 4.0E-38 |
| sp|Q58DM8|ECHM_BOVIN | Enoyl-CoA hydratase, mitochondrial OS=Bos taurus GN=ECHS1 PE=2 SV=1 | 21 | 275 | 1.0E-37 |
| sp|P14604|ECHM_RAT | Enoyl-CoA hydratase, mitochondrial OS=Rattus norvegicus GN=Echs1 PE=1 SV=1 | 23 | 275 | 2.0E-37 |
| sp|Q52995|ECHH_RHIME | Probable enoyl-CoA hydratase OS=Rhizobium meliloti (strain 1021) GN=fadB1 PE=3 SV=2 | 20 | 275 | 2.0E-35 |
| sp|O34893|YNGF_BACSU | Putative enoyl-CoA hydratase/isomerase YngF OS=Bacillus subtilis (strain 168) GN=yngF PE=3 SV=1 | 12 | 274 | 8.0E-35 |
| sp|Q869N6|CRTL_DICDI | 3-hydroxybutyryl-CoA dehydratase-like protein, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0271866 PE=3 SV=1 | 23 | 271 | 9.0E-31 |
| sp|O69762|HCHL_PSEFL | Hydroxycinnamoyl-CoA hydratase-lyase OS=Pseudomonas fluorescens PE=1 SV=1 | 20 | 270 | 7.0E-30 |
| sp|Q54SS0|ECH1_DICDI | Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Dictyostelium discoideum GN=ech1 PE=3 SV=1 | 26 | 274 | 8.0E-29 |
| sp|Q5RFG0|ECH1_PONAB | Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Pongo abelii GN=ECH1 PE=2 SV=1 | 8 | 240 | 2.0E-26 |
| sp|Q7U004|ECH12_MYCBO | Probable enoyl-CoA hydratase echA12 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA12 PE=3 SV=1 | 16 | 275 | 2.0E-26 |
| sp|Q13011|ECH1_HUMAN | Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Homo sapiens GN=ECH1 PE=1 SV=2 | 8 | 240 | 2.0E-26 |
| sp|P9WNN7|ECH12_MYCTU | Probable enoyl-CoA hydratase echA12 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA12 PE=1 SV=1 | 16 | 275 | 4.0E-26 |
| sp|P9WNN6|ECH12_MYCTO | Probable enoyl-CoA hydratase echA12 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA12 PE=3 SV=1 | 16 | 275 | 4.0E-26 |
| sp|Q62651|ECH1_RAT | Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Rattus norvegicus GN=Ech1 PE=1 SV=2 | 6 | 240 | 4.0E-26 |
| sp|O35459|ECH1_MOUSE | Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Mus musculus GN=Ech1 PE=1 SV=1 | 6 | 269 | 4.0E-26 |
| sp|P53526|ECH12_MYCLE | Probable enoyl-CoA hydratase echA12 OS=Mycobacterium leprae (strain TN) GN=echA12 PE=3 SV=1 | 2 | 228 | 8.0E-26 |
| sp|P94549|FADB_BACSU | Probable enoyl-CoA hydratase OS=Bacillus subtilis (strain 168) GN=fadB PE=2 SV=1 | 20 | 274 | 2.0E-25 |
| sp|Q8GYN9|MENB_ARATH | 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal OS=Arabidopsis thaliana GN=MENB PE=1 SV=2 | 26 | 271 | 2.0E-24 |
| sp|Q54HG7|AUHM_DICDI | Methylglutaconyl-CoA hydratase, mitochondrial OS=Dictyostelium discoideum GN=auh PE=3 SV=1 | 25 | 274 | 2.0E-24 |
| sp|Q86YB7|ECHD2_HUMAN | Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Homo sapiens GN=ECHDC2 PE=1 SV=2 | 9 | 271 | 2.0E-24 |
| sp|Q4L549|MENB_STAHJ | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=menB PE=3 SV=1 | 12 | 271 | 2.0E-23 |
| sp|Q2TBT3|ECHD2_BOVIN | Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Bos taurus GN=ECHDC2 PE=2 SV=1 | 7 | 271 | 3.0E-22 |
| sp|Q3TLP5|ECHD2_MOUSE | Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Mus musculus GN=Echdc2 PE=1 SV=2 | 10 | 271 | 3.0E-22 |
| sp|Q7A6A9|MENB_STAAN | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain N315) GN=menB PE=1 SV=1 | 12 | 271 | 4.0E-22 |
| sp|Q99V48|MENB_STAAM | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menB PE=3 SV=1 | 12 | 271 | 4.0E-22 |
| sp|A0PJR5|ECHD3_DANRE | Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Danio rerio GN=echdc3 PE=2 SV=2 | 11 | 275 | 6.0E-22 |
| sp|Q8NXA0|MENB_STAAW | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MW2) GN=menB PE=3 SV=1 | 12 | 271 | 1.0E-21 |
| sp|Q6GAG7|MENB_STAAS | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MSSA476) GN=menB PE=3 SV=1 | 12 | 271 | 1.0E-21 |
| sp|Q5HQC3|MENB_STAEQ | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menB PE=3 SV=1 | 12 | 271 | 1.0E-21 |
| sp|Q6GI37|MENB_STAAR | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain MRSA252) GN=menB PE=3 SV=1 | 12 | 271 | 2.0E-21 |
| sp|Q5HH38|MENB_STAAC | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus aureus (strain COL) GN=menB PE=1 SV=1 | 12 | 271 | 2.0E-21 |
| sp|Q8CPQ4|MENB_STAES | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menB PE=3 SV=1 | 12 | 271 | 2.0E-21 |
| sp|Q9D7J9|ECHD3_MOUSE | Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Mus musculus GN=Echdc3 PE=1 SV=1 | 26 | 275 | 1.0E-20 |
| sp|A9JS71|ECHD3_XENLA | Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Xenopus laevis GN=echdc3 PE=2 SV=1 | 20 | 273 | 1.0E-20 |
| sp|Q3MIE0|ECHD3_RAT | Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Rattus norvegicus GN=Echdc3 PE=2 SV=1 | 26 | 275 | 2.0E-20 |
| sp|Q66FR8|FADB_YERPS | Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadB PE=3 SV=1 | 10 | 247 | 3.0E-20 |
| sp|B2K0Z6|FADB_YERPB | Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=fadB PE=3 SV=1 | 10 | 247 | 3.0E-20 |
| sp|B1JP63|FADB_YERPY | Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=fadB PE=3 SV=1 | 10 | 247 | 3.0E-20 |
| sp|A4TR27|FADB_YERPP | Fatty acid oxidation complex subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=fadB PE=3 SV=1 | 10 | 247 | 3.0E-20 |
| sp|Q1CN99|FADB_YERPN | Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadB PE=3 SV=1 | 10 | 247 | 3.0E-20 |
| sp|A9R754|FADB_YERPG | Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Angola) GN=fadB PE=3 SV=1 | 10 | 247 | 3.0E-20 |
| sp|Q8ZAN0|FADB_YERPE | Fatty acid oxidation complex subunit alpha OS=Yersinia pestis GN=fadB PE=3 SV=1 | 10 | 247 | 3.0E-20 |
| sp|Q1C2C4|FADB_YERPA | Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadB PE=3 SV=1 | 10 | 247 | 3.0E-20 |
| sp|A7FDF2|FADB_YERP3 | Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadB PE=3 SV=1 | 10 | 247 | 3.0E-20 |
| sp|P9WNP1|ECHA6_MYCTU | Probable enoyl-CoA hydratase echA6 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA6 PE=1 SV=1 | 23 | 271 | 3.0E-20 |
| sp|P9WNP0|ECHA6_MYCTO | Probable enoyl-CoA hydratase echA6 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA6 PE=3 SV=1 | 23 | 271 | 3.0E-20 |
| sp|P64015|ECHA6_MYCBO | Probable enoyl-CoA hydratase echA6 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA6 PE=3 SV=1 | 23 | 271 | 3.0E-20 |
| sp|P44960|MENB_HAEIN | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=menB PE=3 SV=1 | 26 | 271 | 3.0E-20 |
| sp|A8G8D1|FADB_SERP5 | Fatty acid oxidation complex subunit alpha OS=Serratia proteamaculans (strain 568) GN=fadB PE=3 SV=1 | 10 | 219 | 4.0E-20 |
| sp|P23966|MENB_BACSU | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Bacillus subtilis (strain 168) GN=menB PE=1 SV=2 | 21 | 271 | 6.0E-20 |
| sp|Q6DAP5|FADB_PECAS | Fatty acid oxidation complex subunit alpha OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadB PE=3 SV=1 | 10 | 247 | 6.0E-20 |
| sp|P45361|CRT_PEPDI | Short-chain-enoyl-CoA hydratase (Fragment) OS=Peptoclostridium difficile GN=crt PE=3 SV=1 | 109 | 265 | 7.0E-20 |
| sp|Q9CLV5|MENB_PASMU | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Pasteurella multocida (strain Pm70) GN=menB PE=3 SV=1 | 26 | 271 | 8.0E-20 |
| sp|Q49WG8|MENB_STAS1 | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menB PE=3 SV=1 | 26 | 271 | 9.0E-20 |
| sp|P77467|PAAG_ECOLI | 1,2-epoxyphenylacetyl-CoA isomerase OS=Escherichia coli (strain K12) GN=paaG PE=1 SV=1 | 13 | 271 | 1.0E-19 |
| sp|A1JIG4|FADB_YERE8 | Fatty acid oxidation complex subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadB PE=3 SV=1 | 10 | 247 | 1.0E-19 |
| sp|Q96DC8|ECHD3_HUMAN | Enoyl-CoA hydratase domain-containing protein 3, mitochondrial OS=Homo sapiens GN=ECHDC3 PE=1 SV=2 | 26 | 275 | 2.0E-19 |
| sp|P9WNP5|MENB_MYCTU | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menB PE=1 SV=1 | 20 | 273 | 3.0E-19 |
| sp|P9WNP4|MENB_MYCTO | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menB PE=3 SV=1 | 20 | 273 | 3.0E-19 |
| sp|P0ABU0|MENB_ECOLI | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Escherichia coli (strain K12) GN=menB PE=1 SV=1 | 26 | 271 | 5.0E-19 |
| sp|P0ABU1|MENB_ECOL6 | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=menB PE=3 SV=1 | 26 | 271 | 5.0E-19 |
| sp|Q7MZ92|FADB_PHOLL | Fatty acid oxidation complex subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadB PE=3 SV=1 | 10 | 247 | 5.0E-19 |
| sp|Q50130|ECHA6_MYCLE | Probable enoyl-CoA hydratase echA6 OS=Mycobacterium leprae (strain TN) GN=echA6 PE=3 SV=1 | 23 | 274 | 6.0E-19 |
| sp|Q5XIE6|HIBCH_RAT | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Rattus norvegicus GN=Hibch PE=1 SV=2 | 25 | 202 | 2.0E-18 |
| sp|Q7CQ56|MENB_SALTY | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=menB PE=1 SV=1 | 26 | 271 | 2.0E-18 |
| sp|A0QRD3|MENB_MYCS2 | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=menB PE=1 SV=1 | 8 | 273 | 2.0E-18 |
| sp|A7MQP0|FADB_CROS8 | Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadB PE=3 SV=1 | 12 | 219 | 3.0E-18 |
| sp|P52045|SCPB_ECOLI | Methylmalonyl-CoA decarboxylase OS=Escherichia coli (strain K12) GN=scpB PE=1 SV=1 | 21 | 271 | 3.0E-18 |
| sp|Q5QXM1|FADJ_IDILO | Fatty acid oxidation complex subunit alpha OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadJ PE=3 SV=1 | 20 | 207 | 3.0E-18 |
| sp|Q07ZP8|FADJ_SHEFN | Fatty acid oxidation complex subunit alpha OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadJ PE=3 SV=1 | 20 | 254 | 5.0E-18 |
| sp|Q1Q8J9|FADB_PSYCK | Fatty acid oxidation complex subunit alpha OS=Psychrobacter cryohalolentis (strain K5) GN=fadB PE=3 SV=1 | 32 | 260 | 1.0E-17 |
| sp|Q8QZS1|HIBCH_MOUSE | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus GN=Hibch PE=1 SV=1 | 25 | 202 | 2.0E-17 |
| sp|Q6NYL3|ECHP_DANRE | Peroxisomal bifunctional enzyme OS=Danio rerio GN=ehhadh PE=2 SV=1 | 20 | 196 | 3.0E-17 |
| sp|Q5LLW6|DMDD_RUEPO | Methylthioacryloyl-CoA hydratase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdD PE=1 SV=1 | 14 | 218 | 4.0E-17 |
| sp|Q9TM10|MENB_CYACA | 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Cyanidium caldarium GN=menB PE=3 SV=1 | 9 | 271 | 5.0E-17 |
| sp|Q9F0Y7|FADB_ENTCL | Fatty acid oxidation complex subunit alpha OS=Enterobacter cloacae GN=fadB PE=3 SV=1 | 12 | 219 | 6.0E-17 |
| sp|Q4FQC6|FADB_PSYA2 | Fatty acid oxidation complex subunit alpha OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=fadB PE=3 SV=1 | 32 | 260 | 7.0E-17 |
| sp|B1KCZ3|FADB_SHEWM | Fatty acid oxidation complex subunit alpha OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=fadB PE=3 SV=1 | 10 | 240 | 1.0E-16 |
| sp|A6TGM4|FADB_KLEP7 | Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-16 |
| sp|Q39659|MFPA_CUCSA | Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Cucumis sativus PE=1 SV=1 | 61 | 214 | 2.0E-16 |
| sp|Q6NMB0|HIBC3_ARATH | Probable 3-hydroxyisobutyryl-CoA hydrolase 3 OS=Arabidopsis thaliana GN=At2g30660 PE=2 SV=1 | 20 | 247 | 2.0E-16 |
| sp|Q4KFC4|FADB_PSEF5 | Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fadB PE=3 SV=1 | 30 | 247 | 2.0E-16 |
| sp|A2VDC2|HIBCH_XENLA | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus laevis GN=hibch PE=2 SV=1 | 25 | 227 | 2.0E-16 |
| sp|B5XYH0|FADB_KLEP3 | Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-16 |
| sp|Q0HWN3|FADJ_SHESR | Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-7) GN=fadJ PE=3 SV=1 | 20 | 210 | 3.0E-16 |
| sp|P41942|YKB4_CAEEL | Uncharacterized protein B0272.4 OS=Caenorhabditis elegans GN=B0272.4 PE=3 SV=1 | 20 | 217 | 3.0E-16 |
| sp|Q8ECP7|FADJ_SHEON | Fatty acid oxidation complex subunit alpha OS=Shewanella oneidensis (strain MR-1) GN=fadJ PE=3 SV=2 | 20 | 210 | 3.0E-16 |
| sp|Q0HKD1|FADJ_SHESM | Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-4) GN=fadJ PE=3 SV=1 | 20 | 210 | 3.0E-16 |
| sp|A4WFX4|FADB_ENT38 | Fatty acid oxidation complex subunit alpha OS=Enterobacter sp. (strain 638) GN=fadB PE=3 SV=1 | 12 | 219 | 3.0E-16 |
| sp|A8GH86|FADJ_SERP5 | Fatty acid oxidation complex subunit alpha OS=Serratia proteamaculans (strain 568) GN=fadJ PE=3 SV=2 | 9 | 212 | 3.0E-16 |
| sp|Q5ZJ60|HIBCH_CHICK | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Gallus gallus GN=HIBCH PE=2 SV=1 | 25 | 185 | 3.0E-16 |
| sp|Q9HZJ2|FADB_PSEAE | Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fadB PE=3 SV=1 | 30 | 247 | 4.0E-16 |
| sp|Q02PH8|FADB_PSEAB | Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fadB PE=3 SV=1 | 30 | 247 | 4.0E-16 |
| sp|B7UYR6|FADB_PSEA8 | Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain LESB58) GN=fadB PE=3 SV=1 | 30 | 247 | 4.0E-16 |
| sp|A1RI92|FADJ_SHESW | Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadJ PE=3 SV=1 | 20 | 210 | 7.0E-16 |
| sp|A8GYG0|FADB_SHEPA | Fatty acid oxidation complex subunit alpha OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=fadB PE=3 SV=1 | 10 | 240 | 7.0E-16 |
| sp|C3K613|FADB_PSEFS | Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain SBW25) GN=fadB PE=3 SV=1 | 30 | 247 | 8.0E-16 |
| sp|P28793|FADB_PSEFR | Fatty acid oxidation complex subunit alpha OS=Pseudomonas fragi GN=fadB PE=1 SV=1 | 30 | 247 | 1.0E-15 |
| sp|B0TLB9|FADB_SHEHH | Fatty acid oxidation complex subunit alpha OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadB PE=3 SV=1 | 10 | 240 | 1.0E-15 |
| sp|A6V382|FADB_PSEA7 | Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain PA7) GN=fadB PE=3 SV=1 | 30 | 247 | 1.0E-15 |
| sp|A0KV76|FADJ_SHESA | Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain ANA-3) GN=fadJ PE=3 SV=1 | 20 | 210 | 1.0E-15 |
| sp|Q83PG1|FADB_SHIFL | Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadB PE=3 SV=4 | 12 | 240 | 1.0E-15 |
| sp|Q0SZ36|FADB_SHIF8 | Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadB PE=3 SV=1 | 12 | 240 | 1.0E-15 |
| sp|Q32A21|FADB_SHIDS | Fatty acid oxidation complex subunit alpha OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadB PE=3 SV=1 | 12 | 219 | 1.0E-15 |
| sp|A4Y897|FADJ_SHEPC | Fatty acid oxidation complex subunit alpha OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadJ PE=3 SV=1 | 20 | 210 | 1.0E-15 |
| sp|Q9JLZ3|AUHM_MOUSE | Methylglutaconyl-CoA hydratase, mitochondrial OS=Mus musculus GN=Auh PE=1 SV=1 | 12 | 274 | 2.0E-15 |
| sp|Q6D2L7|FADJ_PECAS | Fatty acid oxidation complex subunit alpha OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadJ PE=3 SV=1 | 19 | 212 | 2.0E-15 |
| sp|B5YY93|FADB_ECO5E | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-15 |
| sp|Q8X8I2|FADB_ECO57 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-15 |
| sp|B1LM32|FADB_ECOSM | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-15 |
| sp|A8A6V1|FADB_ECOHS | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-15 |
| sp|Q1R466|FADB_ECOUT | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain UTI89 / UPEC) GN=fadB PE=3 SV=2 | 12 | 219 | 2.0E-15 |
| sp|B7MHD1|FADB_ECO45 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-15 |
| sp|Q8FBI2|FADB_ECOL6 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadB PE=3 SV=2 | 12 | 219 | 2.0E-15 |
| sp|B7NV20|FADB_ECO7I | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-15 |
| sp|A5WH99|FADB_PSYWF | Fatty acid oxidation complex subunit alpha OS=Psychrobacter sp. (strain PRwf-1) GN=fadB PE=3 SV=1 | 32 | 260 | 2.0E-15 |
| sp|Q0TAL0|FADB_ECOL5 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-15 |
| sp|B7NFE7|FADB_ECOLU | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-15 |
| sp|B7UNH4|FADB_ECO27 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-15 |
| sp|B7N2F2|FADB_ECO81 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O81 (strain ED1a) GN=fadB PE=3 SV=1 | 12 | 219 | 3.0E-15 |
| sp|Q58EB4|HIBCH_DANRE | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Danio rerio GN=hibch PE=2 SV=1 | 25 | 270 | 3.0E-15 |
| sp|A8ACZ4|FADB_CITK8 | Fatty acid oxidation complex subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadB PE=3 SV=1 | 12 | 219 | 3.0E-15 |
| sp|Q6NVY1|HIBCH_HUMAN | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens GN=HIBCH PE=1 SV=2 | 25 | 241 | 3.0E-15 |
| sp|Q28FR6|HIBCH_XENTR | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Xenopus tropicalis GN=hibch PE=2 SV=1 | 25 | 185 | 4.0E-15 |
| sp|Q9LKJ1|HIBC1_ARATH | 3-hydroxyisobutyryl-CoA hydrolase 1 OS=Arabidopsis thaliana GN=CHY1 PE=1 SV=1 | 20 | 270 | 5.0E-15 |
| sp|B8E3R3|FADB_SHEB2 | Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS223) GN=fadB PE=3 SV=1 | 10 | 240 | 5.0E-15 |
| sp|B1LME7|FADJ_ECOSM | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=fadJ PE=3 SV=1 | 21 | 212 | 5.0E-15 |
| sp|A6WQ25|FADJ_SHEB8 | Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadJ PE=3 SV=1 | 20 | 210 | 5.0E-15 |
| sp|A9KU91|FADB_SHEB9 | Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS195) GN=fadB PE=3 SV=1 | 10 | 240 | 6.0E-15 |
| sp|B0KH74|FADB_PSEPG | Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain GB-1) GN=fadB PE=3 SV=1 | 32 | 247 | 6.0E-15 |
| sp|Q8Z3C6|FADB_SALTI | Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadB PE=3 SV=1 | 12 | 219 | 7.0E-15 |
| sp|B7NP24|FADJ_ECO7I | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadJ PE=3 SV=1 | 21 | 212 | 7.0E-15 |
| sp|A9MYB0|FADB_SALPB | Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadB PE=3 SV=1 | 12 | 219 | 7.0E-15 |
| sp|Q57HM6|FADB_SALCH | Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadB PE=3 SV=2 | 12 | 219 | 7.0E-15 |
| sp|A3CYJ4|FADB_SHEB5 | Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadB PE=3 SV=1 | 10 | 240 | 7.0E-15 |
| sp|B5RFL6|FADB_SALG2 | Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadB PE=3 SV=1 | 12 | 219 | 8.0E-15 |
| sp|B5QW85|FADB_SALEP | Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadB PE=3 SV=1 | 12 | 219 | 8.0E-15 |
| sp|B4TNZ1|FADB_SALSV | Fatty acid oxidation complex subunit alpha OS=Salmonella schwarzengrund (strain CVM19633) GN=fadB PE=3 SV=1 | 12 | 219 | 8.0E-15 |
| sp|Q9L6L5|FADB_SALTY | Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadB PE=3 SV=1 | 12 | 219 | 8.0E-15 |
| sp|A8FP63|FADB_SHESH | Fatty acid oxidation complex subunit alpha OS=Shewanella sediminis (strain HAW-EB3) GN=fadB PE=3 SV=1 | 10 | 240 | 8.0E-15 |
| sp|B5EZW0|FADB_SALA4 | Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadB PE=3 SV=1 | 12 | 219 | 8.0E-15 |
| sp|B5BIZ0|FADB_SALPK | Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain AKU_12601) GN=fadB PE=3 SV=1 | 12 | 219 | 8.0E-15 |
| sp|Q5PKQ2|FADB_SALPA | Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadB PE=3 SV=1 | 12 | 219 | 8.0E-15 |
| sp|A5W6H0|FADB_PSEP1 | Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=fadB PE=3 SV=1 | 32 | 247 | 9.0E-15 |
| sp|A3D684|FADJ_SHEB5 | Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadJ PE=3 SV=1 | 20 | 210 | 9.0E-15 |
| sp|B7LTY9|FADB_ESCF3 | Fatty acid oxidation complex subunit alpha OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadB PE=3 SV=1 | 12 | 219 | 1.0E-14 |
| sp|A5JTM5|CBADH_PSEUC | 4-chlorobenzoyl coenzyme A dehalogenase OS=Pseudomonas sp. (strain CBS-3) PE=1 SV=1 | 20 | 222 | 1.0E-14 |
| sp|Q3YVC1|FADB_SHISS | Fatty acid oxidation complex subunit alpha OS=Shigella sonnei (strain Ss046) GN=fadB PE=3 SV=1 | 12 | 219 | 1.0E-14 |
| sp|P21177|FADB_ECOLI | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) GN=fadB PE=1 SV=2 | 12 | 219 | 1.0E-14 |
| sp|B1XAK8|FADB_ECODH | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / DH10B) GN=fadB PE=3 SV=1 | 12 | 219 | 1.0E-14 |
| sp|C5A020|FADB_ECOBW | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadB PE=3 SV=1 | 12 | 219 | 1.0E-14 |
| sp|P40939|ECHA_HUMAN | Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens GN=HADHA PE=1 SV=2 | 20 | 197 | 1.0E-14 |
| sp|B4SZ85|FADB_SALNS | Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadB PE=3 SV=1 | 12 | 219 | 1.0E-14 |
| sp|Q9AHY3|FADB_PSEPU | Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida GN=fadB PE=3 SV=2 | 32 | 247 | 1.0E-14 |
| sp|B1J5A5|FADB_PSEPW | Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain W619) GN=fadB PE=3 SV=1 | 32 | 247 | 1.0E-14 |
| sp|A7ZU51|FADB_ECO24 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadB PE=3 SV=1 | 12 | 219 | 1.0E-14 |
| sp|C6DAL7|FADJ_PECCP | Fatty acid oxidation complex subunit alpha OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadJ PE=3 SV=1 | 32 | 212 | 1.0E-14 |
| sp|Q13825|AUHM_HUMAN | Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens GN=AUH PE=1 SV=1 | 12 | 274 | 1.0E-14 |
| sp|B2TVJ5|FADB_SHIB3 | Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-14 |
| sp|B1IW61|FADB_ECOLC | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-14 |
| sp|B7M649|FADB_ECO8A | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O8 (strain IAI1) GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-14 |
| sp|B7L9A7|FADB_ECO55 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain 55989 / EAEC) GN=fadB PE=3 SV=1 | 12 | 219 | 2.0E-14 |
| sp|Q88L02|FADB_PSEPK | Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain KT2440) GN=fadB PE=3 SV=1 | 32 | 247 | 2.0E-14 |
| sp|Q93Q12|FADB_PSEOL | Fatty acid oxidation complex subunit alpha OS=Pseudomonas oleovorans GN=fadB PE=3 SV=1 | 32 | 247 | 2.0E-14 |
| sp|A7ZPF8|FADJ_ECO24 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-14 |
| sp|B6I6Q4|FADJ_ECOSE | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SE11) GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-14 |
| sp|Q6FF68|FADB_ACIAD | Fatty acid oxidation complex subunit alpha OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fadB PE=3 SV=1 | 32 | 219 | 2.0E-14 |
| sp|Q8FFG4|FADJ_ECOL6 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-14 |
| sp|Q8XCP2|FADJ_ECO57 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-14 |
| sp|Q3K9D8|FADB_PSEPF | Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain Pf0-1) GN=fadB PE=3 SV=1 | 30 | 247 | 2.0E-14 |
| sp|B5YXY4|FADJ_ECO5E | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-14 |
| sp|A6WHA0|FADB_SHEB8 | Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadB PE=3 SV=1 | 10 | 240 | 2.0E-14 |
| sp|B7LBJ5|FADJ_ECO55 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain 55989 / EAEC) GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-14 |
| sp|B7MY16|FADJ_ECO81 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O81 (strain ED1a) GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-14 |
| sp|Q87ZB2|FADB_PSESM | Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fadB PE=3 SV=1 | 30 | 247 | 3.0E-14 |
| sp|B7M6M2|FADJ_ECO8A | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O8 (strain IAI1) GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-14 |
| sp|B2TWV4|FADJ_SHIB3 | Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-14 |
| sp|A8A2L0|FADJ_ECOHS | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-14 |
| sp|Q8EKR9|FADB_SHEON | Fatty acid oxidation complex subunit alpha OS=Shewanella oneidensis (strain MR-1) GN=fadB PE=3 SV=1 | 10 | 240 | 3.0E-14 |
| sp|Q3YZM2|FADJ_SHISS | Fatty acid oxidation complex subunit alpha OS=Shigella sonnei (strain Ss046) GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-14 |
| sp|Q83QQ0|FADJ_SHIFL | Fatty acid oxidation complex subunit alpha OS=Shigella flexneri GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-14 |
| sp|Q0TFA6|FADJ_ECOL5 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-14 |
| sp|Q0T2E6|FADJ_SHIF8 | Fatty acid oxidation complex subunit alpha OS=Shigella flexneri serotype 5b (strain 8401) GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-14 |
| sp|A0KR50|FADB_SHESA | Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain ANA-3) GN=fadB PE=3 SV=1 | 10 | 240 | 3.0E-14 |
| sp|Q1R972|FADJ_ECOUT | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain UTI89 / UPEC) GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-14 |
| sp|A1ADI8|FADJ_ECOK1 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O1:K1 / APEC GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-14 |
| sp|B7MGV7|FADJ_ECO45 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-14 |
| sp|B7UFZ8|FADJ_ECO27 | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-14 |
| sp|Q0HPB7|FADB_SHESM | Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-4) GN=fadB PE=3 SV=1 | 10 | 240 | 3.0E-14 |
| sp|B7N5V2|FADJ_ECOLU | Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-14 |
| sp|Q29554|ECHA_PIG | Trifunctional enzyme subunit alpha, mitochondrial OS=Sus scrofa GN=HADHA PE=1 SV=1 | 20 | 197 | 3.0E-14 |
| sp|Q48GW3|FADB_PSE14 | Fatty acid oxidation complex subunit alpha OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fadB PE=3 SV=1 | 30 | 247 | 4.0E-14 |
| sp|Q6LTK3|FADJ_PHOPR | Fatty acid oxidation complex subunit alpha OS=Photobacterium profundum GN=fadJ PE=3 SV=1 | 14 | 218 | 4.0E-14 |
| sp|Q0I0T3|FADB_SHESR | Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain MR-7) GN=fadB PE=3 SV=1 | 10 | 240 | 4.0E-14 |
| sp|A4VKA3|FADB_PSEU5 | Fatty acid oxidation complex subunit alpha OS=Pseudomonas stutzeri (strain A1501) GN=fadB PE=3 SV=1 | 32 | 247 | 4.0E-14 |
| sp|A1RDW6|FADB_SHESW | Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadB PE=3 SV=1 | 10 | 240 | 4.0E-14 |
| sp|A4Y1B6|FADB_SHEPC | Fatty acid oxidation complex subunit alpha OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadB PE=3 SV=1 | 10 | 240 | 4.0E-14 |
| sp|Q9SHJ8|HIBC8_ARATH | 3-hydroxyisobutyryl-CoA hydrolase-like protein 5 OS=Arabidopsis thaliana GN=At1g06550 PE=1 SV=2 | 23 | 265 | 4.0E-14 |
| sp|B6I4I6|FADB_ECOSE | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain SE11) GN=fadB PE=3 SV=1 | 12 | 219 | 6.0E-14 |
| sp|B1IXA5|FADJ_ECOLC | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=fadJ PE=3 SV=1 | 21 | 212 | 6.0E-14 |
| sp|Q1I7D4|FADB_PSEE4 | Fatty acid oxidation complex subunit alpha OS=Pseudomonas entomophila (strain L48) GN=fadB PE=3 SV=1 | 32 | 247 | 6.0E-14 |
| sp|B4TQC2|FADJ_SALSV | Fatty acid oxidation complex subunit alpha OS=Salmonella schwarzengrund (strain CVM19633) GN=fadJ PE=3 SV=1 | 21 | 212 | 7.0E-14 |
| sp|Q64428|ECHA_RAT | Trifunctional enzyme subunit alpha, mitochondrial OS=Rattus norvegicus GN=Hadha PE=1 SV=2 | 20 | 265 | 7.0E-14 |
| sp|Q08A39|FADB_SHEFN | Fatty acid oxidation complex subunit alpha OS=Shewanella frigidimarina (strain NCIMB 400) GN=fadB PE=3 SV=1 | 10 | 240 | 7.0E-14 |
| sp|Q32DJ4|FADJ_SHIDS | Fatty acid oxidation complex subunit alpha OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=fadJ PE=3 SV=1 | 21 | 212 | 8.0E-14 |
| sp|Q7N288|FADJ_PHOLL | Fatty acid oxidation complex subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadJ PE=3 SV=2 | 21 | 212 | 9.0E-14 |
| sp|B5XVW2|FADJ_KLEP3 | Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadJ PE=3 SV=1 | 21 | 251 | 9.0E-14 |
| sp|A0KEL1|FADB_AERHH | Fatty acid oxidation complex subunit alpha OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=fadB PE=3 SV=1 | 10 | 240 | 1.0E-13 |
| sp|Q668V1|FADJ_YERPS | Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadJ PE=3 SV=2 | 34 | 211 | 1.0E-13 |
| sp|A4TM82|FADJ_YERPP | Fatty acid oxidation complex subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=fadJ PE=3 SV=1 | 34 | 211 | 1.0E-13 |
| sp|Q1CHK2|FADJ_YERPN | Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadJ PE=3 SV=2 | 34 | 211 | 1.0E-13 |
| sp|Q8ZD45|FADJ_YERPE | Fatty acid oxidation complex subunit alpha OS=Yersinia pestis GN=fadJ PE=3 SV=2 | 34 | 211 | 1.0E-13 |
| sp|Q1C660|FADJ_YERPA | Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadJ PE=3 SV=2 | 34 | 211 | 1.0E-13 |
| sp|A7FGK1|FADJ_YERP3 | Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadJ PE=3 SV=1 | 34 | 211 | 1.0E-13 |
| sp|Q8ZNA7|FADJ_SALTY | Fatty acid oxidation complex subunit alpha OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadJ PE=3 SV=1 | 21 | 212 | 1.0E-13 |
| sp|A4WCW6|FADJ_ENT38 | Fatty acid oxidation complex subunit alpha OS=Enterobacter sp. (strain 638) GN=fadJ PE=3 SV=1 | 21 | 212 | 1.0E-13 |
| sp|A4XSM8|FADB_PSEMY | Fatty acid oxidation complex subunit alpha OS=Pseudomonas mendocina (strain ymp) GN=fadB PE=3 SV=1 | 30 | 247 | 1.0E-13 |
| sp|Q31YB7|FADJ_SHIBS | Fatty acid oxidation complex subunit alpha OS=Shigella boydii serotype 4 (strain Sb227) GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-13 |
| sp|Q8Z4Z0|FADJ_SALTI | Fatty acid oxidation complex subunit alpha OS=Salmonella typhi GN=fadJ PE=3 SV=1 | 14 | 212 | 2.0E-13 |
| sp|A4STF2|FADB_AERS4 | Fatty acid oxidation complex subunit alpha OS=Aeromonas salmonicida (strain A449) GN=fadB PE=3 SV=1 | 10 | 240 | 2.0E-13 |
| sp|A9N453|FADJ_SALPB | Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-13 |
| sp|B4SZR0|FADJ_SALNS | Fatty acid oxidation complex subunit alpha OS=Salmonella newport (strain SL254) GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-13 |
| sp|B4TCA8|FADJ_SALHS | Fatty acid oxidation complex subunit alpha OS=Salmonella heidelberg (strain SL476) GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-13 |
| sp|B5EZR9|FADJ_SALA4 | Fatty acid oxidation complex subunit alpha OS=Salmonella agona (strain SL483) GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-13 |
| sp|B5R3R9|FADJ_SALEP | Fatty acid oxidation complex subunit alpha OS=Salmonella enteritidis PT4 (strain P125109) GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-13 |
| sp|B5FPN1|FADJ_SALDC | Fatty acid oxidation complex subunit alpha OS=Salmonella dublin (strain CT_02021853) GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-13 |
| sp|Q57LW6|FADJ_SALCH | Fatty acid oxidation complex subunit alpha OS=Salmonella choleraesuis (strain SC-B67) GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-13 |
| sp|B5RCL3|FADJ_SALG2 | Fatty acid oxidation complex subunit alpha OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=fadJ PE=3 SV=1 | 21 | 212 | 2.0E-13 |
| sp|Q5QXH7|FADB_IDILO | Fatty acid oxidation complex subunit alpha OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=fadB PE=3 SV=1 | 10 | 202 | 2.0E-13 |
| sp|A8ADP2|FADJ_CITK8 | Fatty acid oxidation complex subunit alpha OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=fadJ PE=3 SV=1 | 21 | 210 | 2.0E-13 |
| sp|B8CH91|FADB_SHEPW | Fatty acid oxidation complex subunit alpha OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=fadB PE=3 SV=1 | 10 | 240 | 2.0E-13 |
| sp|A3QFP3|FADJ_SHELP | Fatty acid oxidation complex subunit alpha OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadJ PE=3 SV=1 | 20 | 210 | 3.0E-13 |
| sp|Q4ZRA0|FADB_PSEU2 | Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. syringae (strain B728a) GN=fadB PE=3 SV=1 | 32 | 247 | 3.0E-13 |
| sp|Q5E3U1|FADJ_VIBF1 | Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadJ PE=3 SV=2 | 20 | 198 | 3.0E-13 |
| sp|A5F2P2|FADJ_VIBC3 | Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadJ PE=3 SV=1 | 10 | 212 | 3.0E-13 |
| sp|Q9KT58|FADJ_VIBCH | Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadJ PE=3 SV=2 | 10 | 212 | 3.0E-13 |
| sp|P77399|FADJ_ECOLI | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) GN=fadJ PE=1 SV=1 | 21 | 212 | 3.0E-13 |
| sp|B1X9L4|FADJ_ECODH | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / DH10B) GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-13 |
| sp|C4ZVN2|FADJ_ECOBW | Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=fadJ PE=3 SV=1 | 21 | 212 | 3.0E-13 |
| sp|Q8BMS1|ECHA_MOUSE | Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus GN=Hadha PE=1 SV=1 | 20 | 197 | 4.0E-13 |
| sp|A1JK30|FADJ_YERE8 | Fatty acid oxidation complex subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadJ PE=3 SV=2 | 112 | 211 | 4.0E-13 |
| sp|B7LLD0|FADJ_ESCF3 | Fatty acid oxidation complex subunit alpha OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=fadJ PE=3 SV=1 | 21 | 212 | 4.0E-13 |
| sp|Q6LW06|FADB_PHOPR | Fatty acid oxidation complex subunit alpha OS=Photobacterium profundum GN=fadB PE=3 SV=1 | 10 | 253 | 4.0E-13 |
| sp|A1S1I8|FADB_SHEAM | Fatty acid oxidation complex subunit alpha OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadB PE=3 SV=1 | 10 | 240 | 5.0E-13 |
| sp|A6TC19|FADJ_KLEP7 | Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadJ PE=3 SV=1 | 21 | 240 | 6.0E-13 |
| sp|A1S7L6|FADJ_SHEAM | Fatty acid oxidation complex subunit alpha OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=fadJ PE=3 SV=1 | 14 | 210 | 6.0E-13 |
| sp|Q87TN9|FADB_VIBPA | Fatty acid oxidation complex subunit alpha OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadB PE=3 SV=1 | 10 | 240 | 7.0E-13 |
| sp|Q8DR19|FABM_STRR6 | Trans-2-decenoyl-[acyl-carrier-protein] isomerase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=fabM PE=1 SV=1 | 20 | 271 | 8.0E-13 |
| sp|Q8DDK6|FADB_VIBVU | Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain CMCP6) GN=fadB PE=3 SV=1 | 10 | 240 | 8.0E-13 |
| sp|Q08426|ECHP_HUMAN | Peroxisomal bifunctional enzyme OS=Homo sapiens GN=EHHADH PE=1 SV=3 | 21 | 200 | 9.0E-13 |
| sp|B0VE45|FADB_ACIBY | Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AYE) GN=fadB PE=3 SV=1 | 61 | 215 | 9.0E-13 |
| sp|B7I3P1|FADB_ACIB5 | Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AB0057) GN=fadB PE=3 SV=1 | 61 | 215 | 9.0E-13 |
| sp|B7H1I0|FADB_ACIB3 | Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AB307-0294) GN=fadB PE=3 SV=1 | 61 | 215 | 9.0E-13 |
| sp|B2I2J9|FADB_ACIBC | Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain ACICU) GN=fadB PE=3 SV=1 | 61 | 215 | 1.0E-12 |
| sp|P28817|HIBCH_YEAST | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EHD3 PE=1 SV=2 | 25 | 186 | 1.0E-12 |
| sp|Q9T0K7|HIBC6_ARATH | 3-hydroxyisobutyryl-CoA hydrolase-like protein 3, mitochondrial OS=Arabidopsis thaliana GN=At4g13360 PE=1 SV=2 | 18 | 277 | 1.0E-12 |
| sp|B5BBA1|FADJ_SALPK | Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain AKU_12601) GN=fadJ PE=3 SV=1 | 21 | 212 | 1.0E-12 |
| sp|Q5PCX6|FADJ_SALPA | Fatty acid oxidation complex subunit alpha OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=fadJ PE=3 SV=1 | 21 | 212 | 1.0E-12 |
| sp|B0VLX4|FADB_ACIBS | Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain SDF) GN=fadB PE=3 SV=1 | 61 | 215 | 1.0E-12 |
| sp|A3Q8U4|FADB_SHELP | Fatty acid oxidation complex subunit alpha OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=fadB PE=3 SV=1 | 10 | 240 | 2.0E-12 |
| sp|P9WNN3|ECH17_MYCTU | Probable enoyl-CoA hydratase echA17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA17 PE=1 SV=1 | 25 | 228 | 2.0E-12 |
| sp|P9WNN2|ECH17_MYCTO | Probable enoyl-CoA hydratase echA17 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA17 PE=3 SV=1 | 25 | 228 | 2.0E-12 |
| sp|A5U753|ECH17_MYCTA | Probable enoyl-CoA hydratase echA17 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=echA17 PE=3 SV=1 | 25 | 228 | 2.0E-12 |
| sp|A1KN36|ECH17_MYCBP | Probable enoyl-CoA hydratase echA17 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=echA17 PE=3 SV=1 | 25 | 228 | 2.0E-12 |
| sp|Q7TXE1|ECH17_MYCBO | Probable enoyl-CoA hydratase echA17 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA17 PE=1 SV=1 | 25 | 228 | 2.0E-12 |
| sp|B0TL21|FADJ_SHEHH | Fatty acid oxidation complex subunit alpha OS=Shewanella halifaxensis (strain HAW-EB4) GN=fadJ PE=3 SV=1 | 20 | 210 | 2.0E-12 |
| sp|A7MH81|FADJ_CROS8 | Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadJ PE=3 SV=1 | 19 | 212 | 2.0E-12 |
| sp|B6EGU2|FADB_ALISL | Fatty acid oxidation complex subunit alpha OS=Aliivibrio salmonicida (strain LFI1238) GN=fadB PE=3 SV=1 | 10 | 212 | 2.0E-12 |
| sp|P40802|PKSI_BACSU | Putative polyketide biosynthesis enoyl-CoA isomerase PksI OS=Bacillus subtilis (strain 168) GN=pksI PE=1 SV=2 | 35 | 254 | 3.0E-12 |
| sp|Q9D5D8|CDYL2_MOUSE | Chromodomain Y-like protein 2 OS=Mus musculus GN=Cdyl2 PE=1 SV=1 | 21 | 246 | 3.0E-12 |
| sp|A7N1D2|FADB_VIBCB | Fatty acid oxidation complex subunit alpha OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fadB PE=3 SV=1 | 10 | 240 | 3.0E-12 |
| sp|Q8DB47|FADJ_VIBVU | Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain CMCP6) GN=fadJ PE=3 SV=1 | 14 | 254 | 3.0E-12 |
| sp|O74802|HIBCH_SCHPO | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ehd3 PE=3 SV=1 | 20 | 198 | 3.0E-12 |
| sp|Q7MIS5|FADJ_VIBVY | Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain YJ016) GN=fadJ PE=3 SV=1 | 14 | 254 | 4.0E-12 |
| sp|Q5R5M8|ECHP_PONAB | Peroxisomal bifunctional enzyme OS=Pongo abelii GN=EHHADH PE=2 SV=1 | 21 | 200 | 4.0E-12 |
| sp|Q2HJ73|HIBCH_BOVIN | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Bos taurus GN=HIBCH PE=2 SV=1 | 25 | 190 | 6.0E-12 |
| sp|Q8N8U2|CDYL2_HUMAN | Chromodomain Y-like protein 2 OS=Homo sapiens GN=CDYL2 PE=1 SV=2 | 21 | 246 | 6.0E-12 |
| sp|B7VGL4|FADB_VIBTL | Fatty acid oxidation complex subunit alpha OS=Vibrio tasmaniensis (strain LGP32) GN=fadB PE=3 SV=1 | 10 | 207 | 7.0E-12 |
| sp|Q8RXN4|HIBC5_ARATH | 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial OS=Arabidopsis thaliana GN=At4g31810 PE=2 SV=1 | 28 | 185 | 8.0E-12 |
| sp|Q9LCU3|CBAD2_ARTSP | 4-chlorobenzoyl coenzyme A dehalogenase-2 OS=Arthrobacter sp. GN=fcbB2 PE=1 SV=1 | 23 | 222 | 9.0E-12 |
| sp|Q9D9V3|ECHD1_MOUSE | Ethylmalonyl-CoA decarboxylase OS=Mus musculus GN=Echdc1 PE=1 SV=2 | 20 | 240 | 1.0E-11 |
| sp|Q7MQH9|FADB_VIBVY | Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain YJ016) GN=fadB PE=3 SV=1 | 10 | 240 | 1.0E-11 |
| sp|Q1PEY5|HIBC2_ARATH | Probable 3-hydroxyisobutyryl-CoA hydrolase 2 OS=Arabidopsis thaliana GN=At2g30650 PE=2 SV=1 | 20 | 265 | 1.0E-11 |
| sp|C3LSI3|FADB_VIBCM | Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain M66-2) GN=fadB PE=3 SV=1 | 10 | 240 | 1.0E-11 |
| sp|Q9KNI1|FADB_VIBCH | Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fadB PE=3 SV=1 | 10 | 240 | 1.0E-11 |
| sp|O85078|CBAD1_ARTSP | 4-chlorobenzoyl coenzyme A dehalogenase-1 OS=Arthrobacter sp. GN=fcbB1 PE=1 SV=2 | 23 | 222 | 1.0E-11 |
| sp|A5F465|FADB_VIBC3 | Fatty acid oxidation complex subunit alpha OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=fadB PE=3 SV=1 | 10 | 240 | 2.0E-11 |
| sp|P9WNN5|ECH14_MYCTU | Probable enoyl-CoA hydratase echA14 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=echA14 PE=1 SV=1 | 9 | 210 | 2.0E-11 |
| sp|P9WNN4|ECH14_MYCTO | Probable enoyl-CoA hydratase echA14 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=echA14 PE=3 SV=1 | 9 | 210 | 2.0E-11 |
| sp|P64019|ECH14_MYCBO | Probable enoyl-CoA hydratase echA14 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=echA14 PE=1 SV=1 | 9 | 210 | 2.0E-11 |
| sp|Q9Y232|CDYL1_HUMAN | Chromodomain Y-like protein OS=Homo sapiens GN=CDYL PE=1 SV=2 | 22 | 269 | 2.0E-11 |
| sp|Q87MM3|FADJ_VIBPA | Fatty acid oxidation complex subunit alpha OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=fadJ PE=3 SV=1 | 16 | 254 | 2.0E-11 |
| sp|O87873|DCH_THAAR | Cyclohexa-1,5-dienecarbonyl-CoA hydratase OS=Thauera aromatica GN=dch PE=1 SV=3 | 20 | 275 | 3.0E-11 |
| sp|A7MS61|FADJ_VIBCB | Fatty acid oxidation complex subunit alpha OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fadJ PE=3 SV=1 | 14 | 254 | 4.0E-11 |
| sp|Q6AYK9|CDYL_RAT | Chromodomain Y-like protein OS=Rattus norvegicus GN=Cdyl PE=1 SV=1 | 22 | 234 | 5.0E-11 |
| sp|Q9LK08|HIBC7_ARATH | 3-hydroxyisobutyryl-CoA hydrolase-like protein 4, mitochondrial OS=Arabidopsis thaliana GN=At3g24360 PE=2 SV=1 | 21 | 277 | 5.0E-11 |
| sp|Q28C91|ECHD1_XENTR | Ethylmalonyl-CoA decarboxylase OS=Xenopus tropicalis GN=echdc1 PE=2 SV=1 | 14 | 175 | 2.0E-10 |
| sp|Q489W3|FADB_COLP3 | Fatty acid oxidation complex subunit alpha OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=fadB PE=3 SV=1 | 61 | 211 | 2.0E-10 |
| sp|Q9WTK2|CDYL_MOUSE | Chromodomain Y-like protein OS=Mus musculus GN=Cdyl PE=1 SV=1 | 22 | 269 | 2.0E-10 |
| sp|F1NB38|ECHD1_CHICK | Ethylmalonyl-CoA decarboxylase OS=Gallus gallus GN=ECHDC1 PE=3 SV=2 | 14 | 175 | 2.0E-10 |
| sp|Q5HZQ8|ECHD1_XENLA | Ethylmalonyl-CoA decarboxylase OS=Xenopus laevis GN=echdc1 PE=2 SV=1 | 14 | 175 | 3.0E-10 |
| sp|P55100|ECHP_CAVPO | Peroxisomal bifunctional enzyme OS=Cavia porcellus GN=EHHADH PE=2 SV=2 | 22 | 218 | 3.0E-10 |
| sp|Q5R4W0|ECHD1_PONAB | Ethylmalonyl-CoA decarboxylase OS=Pongo abelii GN=ECHDC1 PE=2 SV=1 | 8 | 245 | 3.0E-10 |
| sp|F1R6N4|ECHD1_DANRE | Ethylmalonyl-CoA decarboxylase OS=Danio rerio GN=echdc1 PE=3 SV=2 | 5 | 255 | 3.0E-10 |
| sp|Q9NTX5|ECHD1_HUMAN | Ethylmalonyl-CoA decarboxylase OS=Homo sapiens GN=ECHDC1 PE=1 SV=2 | 8 | 245 | 4.0E-10 |
| sp|Q55GS6|HIBCH_DICDI | 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Dictyostelium discoideum GN=hibch PE=3 SV=1 | 23 | 186 | 4.0E-10 |
| sp|Q5E8X6|FADB_VIBF1 | Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=fadB PE=3 SV=1 | 10 | 219 | 4.0E-10 |
| sp|Q5XF59|HIBC4_ARATH | 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=At3g60510 PE=2 SV=1 | 28 | 224 | 5.0E-10 |
| sp|Q73VC7|ECH17_MYCPA | Probable enoyl-CoA hydratase echA17 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=echA17 PE=3 SV=1 | 25 | 225 | 5.0E-10 |
| sp|A0QJH8|ECH17_MYCA1 | Probable enoyl-CoA hydratase echA17 OS=Mycobacterium avium (strain 104) GN=echA17 PE=3 SV=1 | 25 | 225 | 6.0E-10 |
| sp|B5FEW8|FADB_VIBFM | Fatty acid oxidation complex subunit alpha OS=Vibrio fischeri (strain MJ11) GN=fadB PE=3 SV=1 | 10 | 219 | 6.0E-10 |
| sp|Q6AYG5|ECHD1_RAT | Ethylmalonyl-CoA decarboxylase OS=Rattus norvegicus GN=Echdc1 PE=1 SV=1 | 8 | 214 | 1.0E-09 |
| sp|Q2HJD5|ECHD1_BOVIN | Ethylmalonyl-CoA decarboxylase OS=Bos taurus GN=ECHDC1 PE=2 SV=1 | 8 | 245 | 2.0E-09 |
| sp|Q9ZPI5|MFP2_ARATH | Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 OS=Arabidopsis thaliana GN=MFP2 PE=1 SV=1 | 61 | 214 | 3.0E-09 |
| sp|P07896|ECHP_RAT | Peroxisomal bifunctional enzyme OS=Rattus norvegicus GN=Ehhadh PE=1 SV=2 | 16 | 216 | 3.0E-09 |
| sp|Q78JN3|ECI3_MOUSE | Enoyl-CoA delta isomerase 3, peroxisomal OS=Mus musculus GN=Eci3 PE=1 SV=1 | 20 | 214 | 5.0E-09 |
| sp|O49809|MFPA_BRANA | Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Brassica napus PE=2 SV=2 | 61 | 206 | 5.0E-09 |
| sp|Q9XB60|CARB_PECCC | Carboxymethylproline synthase OS=Pectobacterium carotovorum subsp. carotovorum GN=carB PE=1 SV=1 | 18 | 228 | 7.0E-09 |
| sp|Q9DBM2|ECHP_MOUSE | Peroxisomal bifunctional enzyme OS=Mus musculus GN=Ehhadh PE=1 SV=4 | 16 | 200 | 9.0E-09 |
| sp|Q8W1L6|MFP_ORYSJ | Peroxisomal fatty acid beta-oxidation multifunctional protein OS=Oryza sativa subsp. japonica GN=MFP PE=1 SV=2 | 21 | 213 | 1.0E-08 |
| sp|Q84HH6|BOXC_AZOEV | Benzoyl-CoA-dihydrodiol lyase OS=Azoarcus evansii GN=boxC PE=1 SV=1 | 40 | 163 | 1.0E-08 |
| sp|Q9WUR2|ECI2_MOUSE | Enoyl-CoA delta isomerase 2, mitochondrial OS=Mus musculus GN=Eci2 PE=1 SV=2 | 20 | 214 | 2.0E-08 |
| sp|Q9Y6F8|CDY1_HUMAN | Testis-specific chromodomain protein Y 1 OS=Homo sapiens GN=CDY1 PE=1 SV=1 | 60 | 246 | 3.0E-08 |
| sp|Q8DSN0|FABM_STRMU | Trans-2-decenoyl-[acyl-carrier-protein] isomerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fabM PE=3 SV=1 | 20 | 271 | 4.0E-08 |
| sp|Q5XIC0|ECI2_RAT | Enoyl-CoA delta isomerase 2, mitochondrial OS=Rattus norvegicus GN=Eci2 PE=1 SV=1 | 20 | 237 | 4.0E-08 |
| sp|Q9ZPI6|AIM1_ARATH | Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1 OS=Arabidopsis thaliana GN=AIM1 PE=1 SV=1 | 23 | 223 | 3.0E-07 |
| sp|O75521|ECI2_HUMAN | Enoyl-CoA delta isomerase 2, mitochondrial OS=Homo sapiens GN=ECI2 PE=1 SV=4 | 20 | 214 | 3.0E-07 |
| sp|O07533|YHAR_BACSU | Putative enoyl-CoA hydratase/isomerase YhaR OS=Bacillus subtilis (strain 168) GN=yhaR PE=3 SV=4 | 26 | 274 | 6.0E-07 |
| sp|Q9Y6F7|CDY2_HUMAN | Testis-specific chromodomain protein Y 2 OS=Homo sapiens GN=CDY2A PE=1 SV=1 | 60 | 246 | 3.0E-06 |
| sp|Q05871|ECI1_YEAST | 3,2-trans-enoyl-CoA isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECI1 PE=1 SV=1 | 20 | 220 | 4.0E-06 |
| sp|P42125|ECI1_MOUSE | Enoyl-CoA delta isomerase 1, mitochondrial OS=Mus musculus GN=Eci1 PE=1 SV=2 | 23 | 228 | 6.0E-06 |
| sp|Q39TV7|BAMA_GEOMG | 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=bamA PE=1 SV=1 | 26 | 199 | 9.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0003824 | catalytic activity | Yes |
| GO:0003674 | molecular_function | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 12 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 86.84 | 44.86 | 128.83 |
| Initials | Initials knots | 36.50 | 19.88 | 53.12 |
| Pileal_Stipeal_center | Stage I stipe center | 89.53 | 53.11 | 125.95 |
| Pileal_Stipeal_shell | Stage I stipe shell | 90.51 | 53.81 | 127.20 |
| DIF_stipe_center | Stage II stipe center | 94.38 | 56.03 | 132.73 |
| DIF_stipe_shell | Stage II stipe shell | 71.80 | 42.02 | 101.58 |
| DIF_stipe_skin | Stage II stipe skin | 89.13 | 52.91 | 125.35 |
| DIF_cap_skin | Stage II cap skin | 177.02 | 104.42 | 249.62 |
| DIF_cap_tissue | Stage II cap tissue | 139.27 | 78.32 | 200.22 |
| DIF_gill_tissue | Stage II gill tissue | 85.14 | 50.40 | 119.87 |
| YFB_stipe_center | Young fruiting body stipe center | 111.82 | 64.47 | 159.18 |
| YFB_stipe_shell | Young fruiting body stipe shell | 93.56 | 54.95 | 132.18 |
| YFB_stipe_skin | Young fruiting body stipe skin | 115.64 | 66.24 | 165.04 |
| YFB_cap_skin | Young fruiting body cap skin | 170.71 | 102.62 | 238.80 |
| YFB_cap_tissue | Young fruiting body cap tissue | 90.23 | 53.42 | 127.03 |
| YFB_gill_tissue | Young fruiting body gill tissue | 125.02 | 73.63 | 176.42 |
| YFB_veil | Young fruiting body veil | 71.18 | 41.58 | 100.78 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.972845 | no |
| Casing | YFB_stipe_center | 0.512296 | no |
| Casing | YFB_stipe_shell | 0.889755 | no |
| Casing | YFB_stipe_skin | 0.443507 | no |
| Casing | YFB_cap_skin | 0.015529 | yes |
| Casing | YFB_cap_tissue | 0.947148 | no |
| Casing | YFB_gill_tissue | 0.277880 | no |
| Casing | YFB_veil | 0.630938 | no |
| Casing | Initials | 0.003365 | yes |
| Casing | Pileal_Stipeal_center | 0.958862 | no |
| Casing | Pileal_Stipeal_shell | 0.941994 | no |
| Casing | DIF_stipe_center | 0.873326 | no |
| Casing | DIF_stipe_shell | 0.648699 | no |
| Casing | DIF_stipe_skin | 0.965472 | no |
| Casing | DIF_cap_skin | 0.009446 | yes |
| Casing | DIF_cap_tissue | 0.142370 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.422885 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.845495 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.353355 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.007092 | yes |
| DIF_gill_tissue | YFB_cap_tissue | 0.912382 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.198297 | no |
| DIF_gill_tissue | YFB_veil | 0.649771 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.646489 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.952130 | no |
| YFB_stipe_center | YFB_cap_skin | 0.140560 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.551685 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.807183 | no |
| YFB_stipe_center | YFB_veil | 0.120972 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.570538 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.020260 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.944937 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.373669 | no |
| YFB_stipe_shell | YFB_veil | 0.413939 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.196877 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.483762 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.879740 | no |
| YFB_stipe_skin | YFB_veil | 0.096464 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.012880 | yes |
| YFB_cap_skin | YFB_gill_tissue | 0.326848 | no |
| YFB_cap_skin | YFB_veil | 0.000613 | yes |
| YFB_cap_tissue | YFB_gill_tissue | 0.301086 | no |
| YFB_cap_tissue | YFB_veil | 0.501663 | no |
| YFB_gill_tissue | YFB_veil | 0.035993 | yes |
| Initials | DIF_gill_tissue | 0.001625 | yes |
| Initials | YFB_stipe_center | 0.000613 | yes |
| Initials | YFB_stipe_shell | 0.000613 | yes |
| Initials | YFB_stipe_skin | 0.000613 | yes |
| Initials | YFB_cap_skin | 0.000613 | yes |
| Initials | YFB_cap_tissue | 0.000613 | yes |
| Initials | YFB_gill_tissue | 0.000613 | yes |
| Initials | YFB_veil | 0.019715 | yes |
| Initials | Pileal_Stipeal_center | 0.000613 | yes |
| Initials | Pileal_Stipeal_shell | 0.000613 | yes |
| Initials | DIF_stipe_center | 0.000613 | yes |
| Initials | DIF_stipe_shell | 0.016386 | yes |
| Initials | DIF_stipe_skin | 0.000613 | yes |
| Initials | DIF_cap_skin | 0.000613 | yes |
| Initials | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.925104 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.541716 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.935163 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.465847 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.009773 | yes |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.988776 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.285450 | no |
| Pileal_Stipeal_center | YFB_veil | 0.519828 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.985262 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.920226 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.539009 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.993194 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.007092 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.137455 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.904332 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.573318 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.950445 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.497077 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.012577 | yes |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.994951 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.308718 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.497019 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.936308 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.517857 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.978283 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.009123 | yes |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.146322 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.824979 | no |
| DIF_stipe_center | YFB_stipe_center | 0.675537 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.987067 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.597707 | no |
| DIF_stipe_center | YFB_cap_skin | 0.028437 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.933322 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.403305 | no |
| DIF_stipe_center | YFB_veil | 0.400686 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.422958 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.914434 | no |
| DIF_stipe_center | DIF_cap_skin | 0.019987 | yes |
| DIF_stipe_center | DIF_cap_tissue | 0.214934 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.676653 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.132135 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.440020 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.102830 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.528583 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.041386 | yes |
| DIF_stipe_shell | YFB_veil | 0.987027 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.566993 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | DIF_cap_tissue | 0.017507 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.930692 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.535378 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.926497 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.459539 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.009773 | yes |
| DIF_stipe_skin | YFB_cap_tissue | 0.982475 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.279565 | no |
| DIF_stipe_skin | YFB_veil | 0.535433 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.007782 | yes |
| DIF_stipe_skin | DIF_cap_tissue | 0.140560 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.002525 | yes |
| DIF_cap_skin | YFB_stipe_center | 0.109313 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.013186 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.153410 | no |
| DIF_cap_skin | YFB_cap_skin | 0.947412 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.008121 | yes |
| DIF_cap_skin | YFB_gill_tissue | 0.268563 | no |
| DIF_cap_skin | YFB_veil | 0.000613 | yes |
| DIF_cap_skin | DIF_cap_tissue | 0.525485 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.086416 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.571093 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.191098 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.655336 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.598606 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.142501 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.824406 | no |
| DIF_cap_tissue | YFB_veil | 0.013186 | yes |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|001300 MTVALVPPAHSDELQISFPENHVLLLTLNRPKSLNAMTPQMSDDLGRVLDWFENEPSLWVVIVTGAGRIFCAGAD LKAWNKNQQAGSSKEQEGLEGDPYGFGSISRRQSNKPFIAAVNGGAFGGGTEIVLNCDIVVASHDAKFALPEVKR GVVAAQGGIPRLSHIAGHQLASEMLLTGRTISATDASNRFGFVNAVVPADQLLPTALAIAKEILSNSPDAVQSTK HALLLSQKLNHHESFIKHAWSKVSSRVYGGENIKEGLKAFSERRAPIWKNPAKL* |
| Coding | >AgabiH97|001300 ATGACAGTAGCGCTCGTACCTCCTGCTCACTCGGATGAGCTTCAAATTTCCTTCCCAGAAAATCATGTCCTTCTC CTGACGCTCAATCGACCAAAAAGTCTCAATGCTATGACCCCCCAAATGTCAGACGACCTCGGGCGCGTATTGGAC TGGTTTGAGAATGAGCCCTCACTATGGGTCGTCATAGTGACCGGAGCAGGCAGAATCTTTTGTGCTGGAGCTGAT TTGAAAGCGTGGAATAAAAATCAGCAGGCCGGGTCATCCAAGGAGCAAGAGGGTTTGGAAGGAGATCCGTATGGC TTTGGGTCTATTTCGCGTAGACAGTCTAACAAGCCCTTTATCGCTGCTGTTAACGGAGGCGCCTTTGGAGGTGGT ACTGAAATTGTGTTGAATTGTGATATCGTCGTTGCCAGCCATGATGCCAAGTTTGCTTTGCCCGAAGTTAAGCGT GGTGTCGTTGCAGCTCAGGGAGGTATTCCGCGGTTATCTCACATCGCGGGTCATCAGCTTGCTTCTGAGATGCTA CTTACGGGAAGGACGATCTCCGCCACAGACGCTTCGAATCGGTTTGGCTTCGTGAACGCCGTCGTCCCTGCGGAC CAATTGCTTCCCACAGCATTGGCAATTGCCAAAGAGATCTTATCCAACTCACCTGACGCTGTTCAGAGCACCAAG CATGCCTTATTGCTTTCACAGAAGCTCAATCATCACGAATCTTTTATCAAGCATGCTTGGAGTAAAGTGAGCAGC CGAGTGTATGGGGGCGAGAATATCAAGGAGGGACTCAAAGCGTTCTCGGAGCGGAGGGCGCCGATATGGAAAAAT CCAGCTAAGTTGTAG |
| Transcript | >AgabiH97|001300 ATGACAGTAGCGCTCGTACCTCCTGCTCACTCGGATGAGCTTCAAATTTCCTTCCCAGAAAATCATGTCCTTCTC CTGACGCTCAATCGACCAAAAAGTCTCAATGCTATGACCCCCCAAATGTCAGACGACCTCGGGCGCGTATTGGAC TGGTTTGAGAATGAGCCCTCACTATGGGTCGTCATAGTGACCGGAGCAGGCAGAATCTTTTGTGCTGGAGCTGAT TTGAAAGCGTGGAATAAAAATCAGCAGGCCGGGTCATCCAAGGAGCAAGAGGGTTTGGAAGGAGATCCGTATGGC TTTGGGTCTATTTCGCGTAGACAGTCTAACAAGCCCTTTATCGCTGCTGTTAACGGAGGCGCCTTTGGAGGTGGT ACTGAAATTGTGTTGAATTGTGATATCGTCGTTGCCAGCCATGATGCCAAGTTTGCTTTGCCCGAAGTTAAGCGT GGTGTCGTTGCAGCTCAGGGAGGTATTCCGCGGTTATCTCACATCGCGGGTCATCAGCTTGCTTCTGAGATGCTA CTTACGGGAAGGACGATCTCCGCCACAGACGCTTCGAATCGGTTTGGCTTCGTGAACGCCGTCGTCCCTGCGGAC CAATTGCTTCCCACAGCATTGGCAATTGCCAAAGAGATCTTATCCAACTCACCTGACGCTGTTCAGAGCACCAAG CATGCCTTATTGCTTTCACAGAAGCTCAATCATCACGAATCTTTTATCAAGCATGCTTGGAGTAAAGTGAGCAGC CGAGTGTATGGGGGCGAGAATATCAAGGAGGGACTCAAAGCGTTCTCGGAGCGGAGGGCGCCGATATGGAAAAAT CCAGCTAAGTTGTAG |
| Gene | >AgabiH97|001300 ATGACAGTAGCGCTCGTACCTCCTGCTCACTCGGATGAGCTTCAAATTTCCTTCCCAGAAAATCATGTCCTTCTC CTGACGCTCAATCGACCAAAAAGTCTCAATGCTATGACCCCCCAAATGTCAGACGACCTCGGGCGCGTATTGGAC TGGTTTGAGAATGAGCCCTCACTATGGTAATGCTTGGTACTGGACGCAGGCTGTACCAGCTCTCACTTTTTCACC GTAGGGTCGTCATAGTGACCGGAGCAGGCAGAATCTTTTGTGCTGGAGCTGATTTGAAAGCGTTAGTCCGATTTC ATTCGGTCGAGTTATCTCCCGTTGCTCACCGAGACGCTTCTCCTTCCGGCAGGTGGAATAAAAATCAGCAGGCCG GGTCATCCAAGGAGCAAGAGGGTTTGGAAGGAGATCCGTATGGCTTTGGGTCTATTTCGCGTAGACAGTCTAACA AGCCCTTTATCGCTGCTGTTAACGGAGGCGCCTTTGGAGGTGGTACTGAAATTGTGTTGAATTGTGATATCGTCG TTGCCAGCCATGATGCCAAGTTTGCTTTGCCCGAAGTTAAGCGTGGTGTCGTTGCAGCTCAGGGAGGTGAGTAAG AATATATTTTCATATTTCTCCATTGATGTCACCGCGTTGTGCGCTCGAACGACGTGGCGCGCTCGCAATTCGTCA TACGCCCCATGTCCTTTCTCTTCAATTCTAGACCTCTTCACGACCGTCTTATTTATATCACCTGTCAGGTATTCC GCGGTTATCTCACATCGCGGGTCATCAGGTGAGTAGATATCGTCTCTTTCGGGTCATGCCTTCTCCTTTTTCGGG GCCAGTCAGTCATCCGTTGATATGTCTTCATTAAATCGCAACCTGTGATGATCAAAGTCAACGTGAGGCTAGGCC ATGAGGCCATTTGACCAGTTGAAGCTGTGTTGTTCGCCGGACGTTGAATTGACTCTTTCAAATAGCTTGCTTCTG AGATGCTACTTACGGGAAGGACGATCTCCGCCACAGACGCTTCGAATCGGTTTGGCTTGTAAGTAGCTTCCAAAT CGAGTTTTACTTTTTGAATTGCTGACCTGCGTCATGCTGTTCGACTTAAACTACTATTCATGAATGGGGAAAAGC GTGAACGCCGTCGTCCCTGCGGACCAATTGCTTCCCACAGCATTGGCAATTGCCAAAGAGATCTTATCCAACTCA CCTGACGCTGTTCAGAGCACCAAGCATGCCTTATTGCTTTCACAGAAGCTCAATCATCACGAATCTTTTATCAAG CATGCTTGGAGTAAAGTGAGCAGCCGAGTGTATGGGGGCGAGAATATCAAGGTCTGTAATCACTTGAATAAACGT CATAAAAACGTACTCACAACAGTCACCTATTACAGGAGGGACTCAAAGCGTTCTCGGAGGTAAGGCCAATACCCG ATATTCAAATTATCTCGTTAATGCGATATACCCGAATAGCGGAGGGCGCCGATATGGAAAAATCCAGCTAAGTTG TAG |