Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|000570
Gene name
Locationscaffold_1:139439..139822
Strand+
Gene length (bp)383
Transcript length (bp)333
Coding sequence length (bp)333
Protein length (aa) 111

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 47 69 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 0.14 0.00 0.45
Initials Initials knots 1.68 0.00 3.83
Pileal_Stipeal_center Stage I stipe center 0.18 0.00 0.48
Pileal_Stipeal_shell Stage I stipe shell 4.38 0.20 8.56
DIF_stipe_center Stage II stipe center 3.28 0.06 6.51
DIF_stipe_shell Stage II stipe shell 0.16 0.00 0.48
DIF_stipe_skin Stage II stipe skin 0.34 0.00 0.78
DIF_cap_skin Stage II cap skin 4.68 0.47 8.88
DIF_cap_tissue Stage II cap tissue 11.93 3.48 20.38
DIF_gill_tissue Stage II gill tissue 9.92 2.61 17.24
YFB_stipe_center Young fruiting body stipe center 0.93 0.00 2.35
YFB_stipe_shell Young fruiting body stipe shell 0.19 0.00 0.51
YFB_stipe_skin Young fruiting body stipe skin 0.00 0.00 0.00
YFB_cap_skin Young fruiting body cap skin 0.22 0.00 0.55
YFB_cap_tissue Young fruiting body cap tissue 0.76 0.00 2.04
YFB_gill_tissue Young fruiting body gill tissue 0.38 0.00 0.83
YFB_veil Young fruiting body veil 2.10 0.64 3.55

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.512058 no
Casing YFB_stipe_center 0.549195 no
Casing YFB_stipe_shell 1.000000 no
Casing YFB_stipe_skin 1.000000 no
Casing YFB_cap_skin 1.000000 no
Casing YFB_cap_tissue 0.573147 no
Casing YFB_gill_tissue 1.000000 no
Casing YFB_veil 0.514373 no
Casing Initials 0.515361 no
Casing Pileal_Stipeal_center 1.000000 no
Casing Pileal_Stipeal_shell 0.512058 no
Casing DIF_stipe_center 0.512058 no
Casing DIF_stipe_shell 1.000000 no
Casing DIF_stipe_skin 1.000000 no
Casing DIF_cap_skin 0.512058 no
Casing DIF_cap_tissue 0.512058 no
DIF_gill_tissue YFB_stipe_center 0.076984 no
DIF_gill_tissue YFB_stipe_shell 0.498538 no
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.495126 no
DIF_gill_tissue YFB_cap_tissue 0.095644 no
DIF_gill_tissue YFB_gill_tissue 0.356796 no
DIF_gill_tissue YFB_veil 0.099929 no
YFB_stipe_center YFB_stipe_shell 0.568482 no
YFB_stipe_center YFB_stipe_skin 0.033674 yes
YFB_stipe_center YFB_cap_skin 0.576772 no
YFB_stipe_center YFB_cap_tissue 0.932146 no
YFB_stipe_center YFB_gill_tissue 0.680086 no
YFB_stipe_center YFB_veil 0.578509 no
YFB_stipe_shell YFB_stipe_skin 1.000000 no
YFB_stipe_shell YFB_cap_skin 1.000000 no
YFB_stipe_shell YFB_cap_tissue 0.624137 no
YFB_stipe_shell YFB_gill_tissue 1.000000 no
YFB_stipe_shell YFB_veil 0.499434 no
YFB_stipe_skin YFB_cap_skin 1.000000 no
YFB_stipe_skin YFB_cap_tissue 0.056760 no
YFB_stipe_skin YFB_gill_tissue 1.000000 no
YFB_stipe_skin YFB_veil 0.004548 yes
YFB_cap_skin YFB_cap_tissue 0.635876 no
YFB_cap_skin YFB_gill_tissue 1.000000 no
YFB_cap_skin YFB_veil 0.498118 no
YFB_cap_tissue YFB_gill_tissue 0.814221 no
YFB_cap_tissue YFB_veil 0.478458 no
YFB_gill_tissue YFB_veil 0.394266 no
Initials DIF_gill_tissue 0.062229 no
Initials YFB_stipe_center 0.697866 no
Initials YFB_stipe_shell 0.505666 no
Initials YFB_stipe_skin 0.004160 yes
Initials YFB_cap_skin 0.504690 no
Initials YFB_cap_tissue 0.595881 no
Initials YFB_gill_tissue 0.434632 no
Initials YFB_veil 0.906680 no
Initials Pileal_Stipeal_center 0.508950 no
Initials Pileal_Stipeal_shell 0.315419 no
Initials DIF_stipe_center 0.521513 no
Initials DIF_stipe_shell 0.522406 no
Initials DIF_stipe_skin 0.429955 no
Initials DIF_cap_skin 0.269471 no
Initials DIF_cap_tissue 0.041164 yes
Pileal_Stipeal_center DIF_gill_tissue 0.506327 no
Pileal_Stipeal_center YFB_stipe_center 0.557601 no
Pileal_Stipeal_center YFB_stipe_shell 1.000000 no
Pileal_Stipeal_center YFB_stipe_skin 1.000000 no
Pileal_Stipeal_center YFB_cap_skin 1.000000 no
Pileal_Stipeal_center YFB_cap_tissue 0.593755 no
Pileal_Stipeal_center YFB_gill_tissue 1.000000 no
Pileal_Stipeal_center YFB_veil 0.509581 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.506327 no
Pileal_Stipeal_center DIF_stipe_center 0.506327 no
Pileal_Stipeal_center DIF_stipe_shell 1.000000 no
Pileal_Stipeal_center DIF_stipe_skin 1.000000 no
Pileal_Stipeal_center DIF_cap_skin 0.506327 no
Pileal_Stipeal_center DIF_cap_tissue 0.506327 no
Pileal_Stipeal_shell DIF_gill_tissue 0.213655 no
Pileal_Stipeal_shell YFB_stipe_center 0.182683 no
Pileal_Stipeal_shell YFB_stipe_shell 0.498538 no
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.495126 no
Pileal_Stipeal_shell YFB_cap_tissue 0.176439 no
Pileal_Stipeal_shell YFB_gill_tissue 0.356879 no
Pileal_Stipeal_shell YFB_veil 0.488978 no
Pileal_Stipeal_shell DIF_stipe_center 0.794583 no
Pileal_Stipeal_shell DIF_stipe_shell 0.518261 no
Pileal_Stipeal_shell DIF_stipe_skin 0.361373 no
Pileal_Stipeal_shell DIF_cap_skin 0.959217 no
Pileal_Stipeal_shell DIF_cap_tissue 0.109622 no
DIF_stipe_center DIF_gill_tissue 0.072330 no
DIF_stipe_center YFB_stipe_center 0.255586 no
DIF_stipe_center YFB_stipe_shell 0.498538 no
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.495126 no
DIF_stipe_center YFB_cap_tissue 0.230769 no
DIF_stipe_center YFB_gill_tissue 0.358658 no
DIF_stipe_center YFB_veil 0.705198 no
DIF_stipe_center DIF_stipe_shell 0.518261 no
DIF_stipe_center DIF_stipe_skin 0.361624 no
DIF_stipe_center DIF_cap_skin 0.714199 no
DIF_stipe_center DIF_cap_tissue 0.035309 yes
DIF_stipe_shell DIF_gill_tissue 0.520190 no
DIF_stipe_shell YFB_stipe_center 0.565575 no
DIF_stipe_shell YFB_stipe_shell 1.000000 no
DIF_stipe_shell YFB_stipe_skin 1.000000 no
DIF_stipe_shell YFB_cap_skin 1.000000 no
DIF_stipe_shell YFB_cap_tissue 0.598176 no
DIF_stipe_shell YFB_gill_tissue 1.000000 no
DIF_stipe_shell YFB_veil 0.523192 no
DIF_stipe_shell DIF_stipe_skin 1.000000 no
DIF_stipe_shell DIF_cap_skin 0.520190 no
DIF_stipe_shell DIF_cap_tissue 0.520190 no
DIF_stipe_skin DIF_gill_tissue 0.352257 no
DIF_stipe_skin YFB_stipe_center 0.636999 no
DIF_stipe_skin YFB_stipe_shell 1.000000 no
DIF_stipe_skin YFB_stipe_skin 1.000000 no
DIF_stipe_skin YFB_cap_skin 1.000000 no
DIF_stipe_skin YFB_cap_tissue 0.713166 no
DIF_stipe_skin YFB_gill_tissue 1.000000 no
DIF_stipe_skin YFB_veil 0.380153 no
DIF_stipe_skin DIF_cap_skin 0.352257 no
DIF_stipe_skin DIF_cap_tissue 0.352257 no
DIF_cap_skin DIF_gill_tissue 0.233086 no
DIF_cap_skin YFB_stipe_center 0.153146 no
DIF_cap_skin YFB_stipe_shell 0.498538 no
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.495126 no
DIF_cap_skin YFB_cap_tissue 0.149346 no
DIF_cap_skin YFB_gill_tissue 0.356879 no
DIF_cap_skin YFB_veil 0.421783 no
DIF_cap_skin DIF_cap_tissue 0.111482 no
DIF_cap_tissue DIF_gill_tissue 0.819146 no
DIF_cap_tissue YFB_stipe_center 0.070317 no
DIF_cap_tissue YFB_stipe_shell 0.498538 no
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.495126 no
DIF_cap_tissue YFB_cap_tissue 0.094821 no
DIF_cap_tissue YFB_gill_tissue 0.356796 no
DIF_cap_tissue YFB_veil 0.067896 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|000570
MKTSVLAIIISFFSFATIFVQALPTPQLLGGGGTGDLVDGVVSTAGGIAGGVAGTVGGVAGGVAPGVLGGGDQPA
PKPAPAPEPAPEPEPSPAPSPAPEPAEPAPVDPSA*
Coding >AgabiH97|000570
ATGAAGACATCCGTCCTCGCCATTATCATCTCTTTCTTTTCCTTCGCTACCATCTTTGTGCAGGCGTTACCCACT
CCCCAACTTCTGGGCGGAGGTGGAACTGGTGACCTTGTCGATGGTGTTGTCAGTACTGCTGGTGGTATTGCAGGC
GGTGTCGCTGGTACTGTTGGCGGTGTCGCTGGTGGTGTCGCTCCCGGCGTCCTCGGTGGTGGTGATCAACCTGCT
CCCAAGCCCGCTCCTGCCCCAGAGCCCGCACCTGAGCCTGAGCCTTCTCCCGCGCCTTCTCCCGCTCCAGAGCCT
GCTGAGCCTGCTCCTGTAGACCCTAGCGCATGA
Transcript >AgabiH97|000570
ATGAAGACATCCGTCCTCGCCATTATCATCTCTTTCTTTTCCTTCGCTACCATCTTTGTGCAGGCGTTACCCACT
CCCCAACTTCTGGGCGGAGGTGGAACTGGTGACCTTGTCGATGGTGTTGTCAGTACTGCTGGTGGTATTGCAGGC
GGTGTCGCTGGTACTGTTGGCGGTGTCGCTGGTGGTGTCGCTCCCGGCGTCCTCGGTGGTGGTGATCAACCTGCT
CCCAAGCCCGCTCCTGCCCCAGAGCCCGCACCTGAGCCTGAGCCTTCTCCCGCGCCTTCTCCCGCTCCAGAGCCT
GCTGAGCCTGCTCCTGTAGACCCTAGCGCATGA
Gene >AgabiH97|000570
ATGAAGACATCCGTCCTCGCCATTATCATCTCTTTCTTTTCCTTCGCTACCATCTTTGTGCAGGCGTTACCCACT
CCCCAACTTCTGGGCGGAGGTGGAACTGGTGACCTTGTCGATGGTGTTGTCAGTACTGCTGGTGGTATTGCAGGC
GGTGTCGCTGGTACTGTTGGCGGTGTCGCTGGTGGTGTCGGTAAGATATACTAGTTTCAAATTCTAATGCAGTTG
CTGATGGTGATGTAGCTCCCGGCGTCCTCGGTGGTGGTGATCAACCTGCTCCCAAGCCCGCTCCTGCCCCAGAGC
CCGCACCTGAGCCTGAGCCTTCTCCCGCGCCTTCTCCCGCTCCAGAGCCTGCTGAGCCTGCTCCTGTAGACCCTA
GCGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail