Protein ID | AgabiH97|000570 |
Gene name | |
Location | scaffold_1:139439..139822 |
Strand | + |
Gene length (bp) | 383 |
Transcript length (bp) | 333 |
Coding sequence length (bp) | 333 |
Protein length (aa) | 111 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
Yes | 1 - 23 | 0.45 |
Domain # | Start | End | Length |
---|---|---|---|
1 | 5 | 27 | 22 |
2 | 47 | 69 | 22 |
Expression values
Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
---|---|---|---|---|
Casing | Casing mycelium | 0.14 | 0.00 | 0.45 |
Initials | Initials knots | 1.68 | 0.00 | 3.83 |
Pileal_Stipeal_center | Stage I stipe center | 0.18 | 0.00 | 0.48 |
Pileal_Stipeal_shell | Stage I stipe shell | 4.38 | 0.20 | 8.56 |
DIF_stipe_center | Stage II stipe center | 3.28 | 0.06 | 6.51 |
DIF_stipe_shell | Stage II stipe shell | 0.16 | 0.00 | 0.48 |
DIF_stipe_skin | Stage II stipe skin | 0.34 | 0.00 | 0.78 |
DIF_cap_skin | Stage II cap skin | 4.68 | 0.47 | 8.88 |
DIF_cap_tissue | Stage II cap tissue | 11.93 | 3.48 | 20.38 |
DIF_gill_tissue | Stage II gill tissue | 9.92 | 2.61 | 17.24 |
YFB_stipe_center | Young fruiting body stipe center | 0.93 | 0.00 | 2.35 |
YFB_stipe_shell | Young fruiting body stipe shell | 0.19 | 0.00 | 0.51 |
YFB_stipe_skin | Young fruiting body stipe skin | 0.00 | 0.00 | 0.00 |
YFB_cap_skin | Young fruiting body cap skin | 0.22 | 0.00 | 0.55 |
YFB_cap_tissue | Young fruiting body cap tissue | 0.76 | 0.00 | 2.04 |
YFB_gill_tissue | Young fruiting body gill tissue | 0.38 | 0.00 | 0.83 |
YFB_veil | Young fruiting body veil | 2.10 | 0.64 | 3.55 |
Differential expression
Label1 | Label2 | Q-value | Significant difference |
---|---|---|---|
Casing | DIF_gill_tissue | 0.512058 | no |
Casing | YFB_stipe_center | 0.549195 | no |
Casing | YFB_stipe_shell | 1.000000 | no |
Casing | YFB_stipe_skin | 1.000000 | no |
Casing | YFB_cap_skin | 1.000000 | no |
Casing | YFB_cap_tissue | 0.573147 | no |
Casing | YFB_gill_tissue | 1.000000 | no |
Casing | YFB_veil | 0.514373 | no |
Casing | Initials | 0.515361 | no |
Casing | Pileal_Stipeal_center | 1.000000 | no |
Casing | Pileal_Stipeal_shell | 0.512058 | no |
Casing | DIF_stipe_center | 0.512058 | no |
Casing | DIF_stipe_shell | 1.000000 | no |
Casing | DIF_stipe_skin | 1.000000 | no |
Casing | DIF_cap_skin | 0.512058 | no |
Casing | DIF_cap_tissue | 0.512058 | no |
DIF_gill_tissue | YFB_stipe_center | 0.076984 | no |
DIF_gill_tissue | YFB_stipe_shell | 0.498538 | no |
DIF_gill_tissue | YFB_stipe_skin | 0.000613 | yes |
DIF_gill_tissue | YFB_cap_skin | 0.495126 | no |
DIF_gill_tissue | YFB_cap_tissue | 0.095644 | no |
DIF_gill_tissue | YFB_gill_tissue | 0.356796 | no |
DIF_gill_tissue | YFB_veil | 0.099929 | no |
YFB_stipe_center | YFB_stipe_shell | 0.568482 | no |
YFB_stipe_center | YFB_stipe_skin | 0.033674 | yes |
YFB_stipe_center | YFB_cap_skin | 0.576772 | no |
YFB_stipe_center | YFB_cap_tissue | 0.932146 | no |
YFB_stipe_center | YFB_gill_tissue | 0.680086 | no |
YFB_stipe_center | YFB_veil | 0.578509 | no |
YFB_stipe_shell | YFB_stipe_skin | 1.000000 | no |
YFB_stipe_shell | YFB_cap_skin | 1.000000 | no |
YFB_stipe_shell | YFB_cap_tissue | 0.624137 | no |
YFB_stipe_shell | YFB_gill_tissue | 1.000000 | no |
YFB_stipe_shell | YFB_veil | 0.499434 | no |
YFB_stipe_skin | YFB_cap_skin | 1.000000 | no |
YFB_stipe_skin | YFB_cap_tissue | 0.056760 | no |
YFB_stipe_skin | YFB_gill_tissue | 1.000000 | no |
YFB_stipe_skin | YFB_veil | 0.004548 | yes |
YFB_cap_skin | YFB_cap_tissue | 0.635876 | no |
YFB_cap_skin | YFB_gill_tissue | 1.000000 | no |
YFB_cap_skin | YFB_veil | 0.498118 | no |
YFB_cap_tissue | YFB_gill_tissue | 0.814221 | no |
YFB_cap_tissue | YFB_veil | 0.478458 | no |
YFB_gill_tissue | YFB_veil | 0.394266 | no |
Initials | DIF_gill_tissue | 0.062229 | no |
Initials | YFB_stipe_center | 0.697866 | no |
Initials | YFB_stipe_shell | 0.505666 | no |
Initials | YFB_stipe_skin | 0.004160 | yes |
Initials | YFB_cap_skin | 0.504690 | no |
Initials | YFB_cap_tissue | 0.595881 | no |
Initials | YFB_gill_tissue | 0.434632 | no |
Initials | YFB_veil | 0.906680 | no |
Initials | Pileal_Stipeal_center | 0.508950 | no |
Initials | Pileal_Stipeal_shell | 0.315419 | no |
Initials | DIF_stipe_center | 0.521513 | no |
Initials | DIF_stipe_shell | 0.522406 | no |
Initials | DIF_stipe_skin | 0.429955 | no |
Initials | DIF_cap_skin | 0.269471 | no |
Initials | DIF_cap_tissue | 0.041164 | yes |
Pileal_Stipeal_center | DIF_gill_tissue | 0.506327 | no |
Pileal_Stipeal_center | YFB_stipe_center | 0.557601 | no |
Pileal_Stipeal_center | YFB_stipe_shell | 1.000000 | no |
Pileal_Stipeal_center | YFB_stipe_skin | 1.000000 | no |
Pileal_Stipeal_center | YFB_cap_skin | 1.000000 | no |
Pileal_Stipeal_center | YFB_cap_tissue | 0.593755 | no |
Pileal_Stipeal_center | YFB_gill_tissue | 1.000000 | no |
Pileal_Stipeal_center | YFB_veil | 0.509581 | no |
Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.506327 | no |
Pileal_Stipeal_center | DIF_stipe_center | 0.506327 | no |
Pileal_Stipeal_center | DIF_stipe_shell | 1.000000 | no |
Pileal_Stipeal_center | DIF_stipe_skin | 1.000000 | no |
Pileal_Stipeal_center | DIF_cap_skin | 0.506327 | no |
Pileal_Stipeal_center | DIF_cap_tissue | 0.506327 | no |
Pileal_Stipeal_shell | DIF_gill_tissue | 0.213655 | no |
Pileal_Stipeal_shell | YFB_stipe_center | 0.182683 | no |
Pileal_Stipeal_shell | YFB_stipe_shell | 0.498538 | no |
Pileal_Stipeal_shell | YFB_stipe_skin | 0.000613 | yes |
Pileal_Stipeal_shell | YFB_cap_skin | 0.495126 | no |
Pileal_Stipeal_shell | YFB_cap_tissue | 0.176439 | no |
Pileal_Stipeal_shell | YFB_gill_tissue | 0.356879 | no |
Pileal_Stipeal_shell | YFB_veil | 0.488978 | no |
Pileal_Stipeal_shell | DIF_stipe_center | 0.794583 | no |
Pileal_Stipeal_shell | DIF_stipe_shell | 0.518261 | no |
Pileal_Stipeal_shell | DIF_stipe_skin | 0.361373 | no |
Pileal_Stipeal_shell | DIF_cap_skin | 0.959217 | no |
Pileal_Stipeal_shell | DIF_cap_tissue | 0.109622 | no |
DIF_stipe_center | DIF_gill_tissue | 0.072330 | no |
DIF_stipe_center | YFB_stipe_center | 0.255586 | no |
DIF_stipe_center | YFB_stipe_shell | 0.498538 | no |
DIF_stipe_center | YFB_stipe_skin | 0.000613 | yes |
DIF_stipe_center | YFB_cap_skin | 0.495126 | no |
DIF_stipe_center | YFB_cap_tissue | 0.230769 | no |
DIF_stipe_center | YFB_gill_tissue | 0.358658 | no |
DIF_stipe_center | YFB_veil | 0.705198 | no |
DIF_stipe_center | DIF_stipe_shell | 0.518261 | no |
DIF_stipe_center | DIF_stipe_skin | 0.361624 | no |
DIF_stipe_center | DIF_cap_skin | 0.714199 | no |
DIF_stipe_center | DIF_cap_tissue | 0.035309 | yes |
DIF_stipe_shell | DIF_gill_tissue | 0.520190 | no |
DIF_stipe_shell | YFB_stipe_center | 0.565575 | no |
DIF_stipe_shell | YFB_stipe_shell | 1.000000 | no |
DIF_stipe_shell | YFB_stipe_skin | 1.000000 | no |
DIF_stipe_shell | YFB_cap_skin | 1.000000 | no |
DIF_stipe_shell | YFB_cap_tissue | 0.598176 | no |
DIF_stipe_shell | YFB_gill_tissue | 1.000000 | no |
DIF_stipe_shell | YFB_veil | 0.523192 | no |
DIF_stipe_shell | DIF_stipe_skin | 1.000000 | no |
DIF_stipe_shell | DIF_cap_skin | 0.520190 | no |
DIF_stipe_shell | DIF_cap_tissue | 0.520190 | no |
DIF_stipe_skin | DIF_gill_tissue | 0.352257 | no |
DIF_stipe_skin | YFB_stipe_center | 0.636999 | no |
DIF_stipe_skin | YFB_stipe_shell | 1.000000 | no |
DIF_stipe_skin | YFB_stipe_skin | 1.000000 | no |
DIF_stipe_skin | YFB_cap_skin | 1.000000 | no |
DIF_stipe_skin | YFB_cap_tissue | 0.713166 | no |
DIF_stipe_skin | YFB_gill_tissue | 1.000000 | no |
DIF_stipe_skin | YFB_veil | 0.380153 | no |
DIF_stipe_skin | DIF_cap_skin | 0.352257 | no |
DIF_stipe_skin | DIF_cap_tissue | 0.352257 | no |
DIF_cap_skin | DIF_gill_tissue | 0.233086 | no |
DIF_cap_skin | YFB_stipe_center | 0.153146 | no |
DIF_cap_skin | YFB_stipe_shell | 0.498538 | no |
DIF_cap_skin | YFB_stipe_skin | 0.000613 | yes |
DIF_cap_skin | YFB_cap_skin | 0.495126 | no |
DIF_cap_skin | YFB_cap_tissue | 0.149346 | no |
DIF_cap_skin | YFB_gill_tissue | 0.356879 | no |
DIF_cap_skin | YFB_veil | 0.421783 | no |
DIF_cap_skin | DIF_cap_tissue | 0.111482 | no |
DIF_cap_tissue | DIF_gill_tissue | 0.819146 | no |
DIF_cap_tissue | YFB_stipe_center | 0.070317 | no |
DIF_cap_tissue | YFB_stipe_shell | 0.498538 | no |
DIF_cap_tissue | YFB_stipe_skin | 0.000613 | yes |
DIF_cap_tissue | YFB_cap_skin | 0.495126 | no |
DIF_cap_tissue | YFB_cap_tissue | 0.094821 | no |
DIF_cap_tissue | YFB_gill_tissue | 0.356796 | no |
DIF_cap_tissue | YFB_veil | 0.067896 | no |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|000570 MKTSVLAIIISFFSFATIFVQALPTPQLLGGGGTGDLVDGVVSTAGGIAGGVAGTVGGVAGGVAPGVLGGGDQPA PKPAPAPEPAPEPEPSPAPSPAPEPAEPAPVDPSA* |
Coding | >AgabiH97|000570 ATGAAGACATCCGTCCTCGCCATTATCATCTCTTTCTTTTCCTTCGCTACCATCTTTGTGCAGGCGTTACCCACT CCCCAACTTCTGGGCGGAGGTGGAACTGGTGACCTTGTCGATGGTGTTGTCAGTACTGCTGGTGGTATTGCAGGC GGTGTCGCTGGTACTGTTGGCGGTGTCGCTGGTGGTGTCGCTCCCGGCGTCCTCGGTGGTGGTGATCAACCTGCT CCCAAGCCCGCTCCTGCCCCAGAGCCCGCACCTGAGCCTGAGCCTTCTCCCGCGCCTTCTCCCGCTCCAGAGCCT GCTGAGCCTGCTCCTGTAGACCCTAGCGCATGA |
Transcript | >AgabiH97|000570 ATGAAGACATCCGTCCTCGCCATTATCATCTCTTTCTTTTCCTTCGCTACCATCTTTGTGCAGGCGTTACCCACT CCCCAACTTCTGGGCGGAGGTGGAACTGGTGACCTTGTCGATGGTGTTGTCAGTACTGCTGGTGGTATTGCAGGC GGTGTCGCTGGTACTGTTGGCGGTGTCGCTGGTGGTGTCGCTCCCGGCGTCCTCGGTGGTGGTGATCAACCTGCT CCCAAGCCCGCTCCTGCCCCAGAGCCCGCACCTGAGCCTGAGCCTTCTCCCGCGCCTTCTCCCGCTCCAGAGCCT GCTGAGCCTGCTCCTGTAGACCCTAGCGCATGA |
Gene | >AgabiH97|000570 ATGAAGACATCCGTCCTCGCCATTATCATCTCTTTCTTTTCCTTCGCTACCATCTTTGTGCAGGCGTTACCCACT CCCCAACTTCTGGGCGGAGGTGGAACTGGTGACCTTGTCGATGGTGTTGTCAGTACTGCTGGTGGTATTGCAGGC GGTGTCGCTGGTACTGTTGGCGGTGTCGCTGGTGGTGTCGGTAAGATATACTAGTTTCAAATTCTAATGCAGTTG CTGATGGTGATGTAGCTCCCGGCGTCCTCGGTGGTGGTGATCAACCTGCTCCCAAGCCCGCTCCTGCCCCAGAGC CCGCACCTGAGCCTGAGCCTTCTCCCGCGCCTTCTCCCGCTCCAGAGCCTGCTGAGCCTGCTCCTGTAGACCCTA GCGCATGA |