Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|000560
Gene name
Locationscaffold_1:135882..138513
Strand-
Gene length (bp)2631
Transcript length (bp)2217
Coding sequence length (bp)2217
Protein length (aa) 739

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10345 Cohesin_load Cohesin loading factor 2.8E-14 288 651

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0007064 mitotic sister chromatid cohesion Yes
GO:0022402 cell cycle process No
GO:1903047 mitotic cell cycle process No
GO:0007062 sister chromatid cohesion No
GO:0016043 cellular component organization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0006996 organelle organization No
GO:0051276 chromosome organization No
GO:0071840 cellular component organization or biogenesis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|000560
MDDDGEQNPRPTKRQKTEDTISAETPKLPHLTLANLLLSLPSLLLHPPTHTNHERSLALSYNALNRCNVLTSLDR
VVECRAATGLVELGLQIGLSTPGVQGEIQKALTKASLVAQNLPSLHLYRHRISQLSSQLSLASGNPKVAQNNLKR
ALSTVTPNDPPHILYSTHLAIIASISSQSSDETTNTMRSLGAISDLHELASKQGHQSMVQLASVLRLRALVRSGL
WDDVGETLDAIEIKLDMAVTLNNYSMDKAKVTEDQGQASLPSPPLTNNSPRSTLEYALIIHSLVLGIIFYTYTGD
SSLATPRLKWLHELLDIQLPHFPKTGIFEIPFSNGPPLHYQLTHPRVIYILGFLVSSLAKRDMMGRKPKKKVFAS
EGIIAIDKELRREIAVPTWASISDVREIDTHFKKLRADLMCEIIGASIMRSEFDEAERSIDELISYTRTQGIFPS
YVARLTLHEAQLAHAQNSHKRALDCYQIASWLSRKRDSKIPIFPQYTKPATKKYYNGSGPSTTNADDDEMIDGEE
DTWINAAARAGELWLRIGLFRQSSSSDMGEEEREKELNRLRKIGESVTKDCRGLGGTLEAIAEVLESCLTKEFTT
AKTHLRRAMNLATNSGDNHLRALVLSLIASHFLHTSYDYAEKMLKSSDSLAAGLGSQPKSSSKKQDTLNSPVKGG
DRAGAPNLQPLTNVAVGNAHLRLWIGERRLELYNRIGNQDAAKMQVGRNGALKEAVARVEATK*
Coding >AgabiH97|000560
ATGGACGACGACGGCGAGCAGAATCCGCGCCCGACAAAACGCCAGAAAACGGAGGACACAATTTCTGCAGAAACA
CCAAAATTGCCACATCTGACCCTCGCCAATCTTCTGCTCAGCCTGCCATCGCTCTTGCTACACCCTCCAACTCAT
ACTAACCATGAACGGTCGCTGGCCTTGTCGTATAATGCACTCAACCGATGTAATGTTCTGACCAGTCTCGATAGA
GTTGTAGAATGTCGCGCAGCTACTGGGTTGGTGGAACTTGGGCTACAGATCGGACTTTCAACTCCTGGCGTACAG
GGCGAGATTCAAAAAGCGCTCACTAAAGCATCTCTCGTAGCACAAAATCTTCCCTCGCTTCATCTCTACAGACAC
CGCATTTCGCAGCTATCCTCGCAGCTCTCCTTGGCTTCCGGAAACCCAAAAGTCGCCCAAAACAATCTCAAACGG
GCCCTATCAACGGTTACTCCAAATGACCCACCGCATATACTCTACTCTACCCATCTCGCTATCATCGCCAGCATC
AGCTCCCAAAGTTCAGACGAAACGACAAATACAATGCGTTCCCTCGGTGCTATCAGTGACCTACATGAACTCGCC
TCGAAGCAAGGTCATCAATCAATGGTCCAGCTTGCCTCAGTCCTGCGTCTCCGTGCACTTGTGCGTTCTGGACTG
TGGGATGACGTTGGAGAGACTTTGGACGCAATTGAAATTAAACTGGATATGGCGGTGACATTAAACAATTATTCT
ATGGATAAAGCAAAAGTCACCGAGGATCAAGGCCAGGCCTCCCTCCCCTCCCCGCCCTTGACTAACAATTCGCCA
AGGTCTACCCTCGAGTATGCGCTAATCATCCATTCCCTTGTCTTGGGCATTATCTTCTACACCTATACTGGAGAC
TCTAGTCTCGCTACCCCAAGATTGAAATGGCTCCATGAACTACTTGATATTCAGTTACCTCATTTTCCAAAAACT
GGTATCTTCGAGATCCCATTTTCGAATGGCCCACCCCTCCATTATCAACTGACTCATCCTAGGGTGATATATATC
CTGGGTTTCCTGGTTTCGAGTCTTGCGAAACGAGATATGATGGGGAGGAAGCCGAAGAAAAAAGTCTTTGCCAGT
GAAGGTATCATCGCGATTGACAAGGAGCTGAGACGGGAAATTGCTGTGCCGACCTGGGCTTCAATATCTGATGTT
AGAGAGATAGATACCCACTTCAAGAAACTTAGGGCTGACCTCATGTGCGAAATCATTGGTGCATCTATCATGAGA
AGCGAGTTTGATGAAGCGGAGCGTTCAATCGACGAACTGATTTCTTATACCCGGACACAAGGAATTTTCCCATCC
TATGTAGCCAGATTGACGCTACACGAAGCCCAGCTAGCACATGCGCAAAATAGCCACAAGCGAGCTCTGGATTGC
TACCAAATAGCATCCTGGCTATCACGAAAACGCGATTCAAAAATACCTATTTTTCCGCAATATACCAAACCTGCA
ACAAAAAAATATTATAATGGATCTGGACCTTCAACTACCAATGCTGACGATGATGAGATGATTGATGGAGAAGAA
GATACGTGGATTAATGCCGCTGCGCGTGCTGGGGAACTTTGGCTTCGGATAGGATTGTTCAGGCAAAGTTCGTCA
TCAGATATGGGAGAGGAGGAGCGAGAAAAGGAGCTGAATAGGCTGAGAAAAATCGGGGAGAGTGTGACTAAAGAT
TGTCGTGGACTTGGTGGGACGTTGGAAGCGATTGCGGAGGTATTGGAAAGTTGTTTAACAAAGGAGTTTACTACA
GCAAAGACGCACCTCAGACGTGCGATGAATCTGGCAACTAATTCGGGCGATAATCATCTTCGTGCTCTTGTTCTT
TCATTGATTGCTTCGCACTTTTTACACACTTCCTATGACTATGCTGAGAAGATGCTCAAATCATCGGATAGTCTC
GCCGCCGGCTTAGGTTCTCAACCTAAATCATCATCGAAAAAGCAGGACACATTAAACTCACCCGTCAAGGGGGGC
GATCGTGCTGGTGCTCCTAATCTACAACCACTGACAAATGTGGCAGTGGGTAATGCACATCTGAGGTTGTGGATT
GGTGAACGGCGTTTAGAGTTGTACAATAGGATAGGGAATCAGGATGCCGCGAAGATGCAGGTTGGGAGGAATGGT
GCTTTGAAGGAAGCTGTTGCTCGGGTGGAGGCGACGAAATAG
Transcript >AgabiH97|000560
ATGGACGACGACGGCGAGCAGAATCCGCGCCCGACAAAACGCCAGAAAACGGAGGACACAATTTCTGCAGAAACA
CCAAAATTGCCACATCTGACCCTCGCCAATCTTCTGCTCAGCCTGCCATCGCTCTTGCTACACCCTCCAACTCAT
ACTAACCATGAACGGTCGCTGGCCTTGTCGTATAATGCACTCAACCGATGTAATGTTCTGACCAGTCTCGATAGA
GTTGTAGAATGTCGCGCAGCTACTGGGTTGGTGGAACTTGGGCTACAGATCGGACTTTCAACTCCTGGCGTACAG
GGCGAGATTCAAAAAGCGCTCACTAAAGCATCTCTCGTAGCACAAAATCTTCCCTCGCTTCATCTCTACAGACAC
CGCATTTCGCAGCTATCCTCGCAGCTCTCCTTGGCTTCCGGAAACCCAAAAGTCGCCCAAAACAATCTCAAACGG
GCCCTATCAACGGTTACTCCAAATGACCCACCGCATATACTCTACTCTACCCATCTCGCTATCATCGCCAGCATC
AGCTCCCAAAGTTCAGACGAAACGACAAATACAATGCGTTCCCTCGGTGCTATCAGTGACCTACATGAACTCGCC
TCGAAGCAAGGTCATCAATCAATGGTCCAGCTTGCCTCAGTCCTGCGTCTCCGTGCACTTGTGCGTTCTGGACTG
TGGGATGACGTTGGAGAGACTTTGGACGCAATTGAAATTAAACTGGATATGGCGGTGACATTAAACAATTATTCT
ATGGATAAAGCAAAAGTCACCGAGGATCAAGGCCAGGCCTCCCTCCCCTCCCCGCCCTTGACTAACAATTCGCCA
AGGTCTACCCTCGAGTATGCGCTAATCATCCATTCCCTTGTCTTGGGCATTATCTTCTACACCTATACTGGAGAC
TCTAGTCTCGCTACCCCAAGATTGAAATGGCTCCATGAACTACTTGATATTCAGTTACCTCATTTTCCAAAAACT
GGTATCTTCGAGATCCCATTTTCGAATGGCCCACCCCTCCATTATCAACTGACTCATCCTAGGGTGATATATATC
CTGGGTTTCCTGGTTTCGAGTCTTGCGAAACGAGATATGATGGGGAGGAAGCCGAAGAAAAAAGTCTTTGCCAGT
GAAGGTATCATCGCGATTGACAAGGAGCTGAGACGGGAAATTGCTGTGCCGACCTGGGCTTCAATATCTGATGTT
AGAGAGATAGATACCCACTTCAAGAAACTTAGGGCTGACCTCATGTGCGAAATCATTGGTGCATCTATCATGAGA
AGCGAGTTTGATGAAGCGGAGCGTTCAATCGACGAACTGATTTCTTATACCCGGACACAAGGAATTTTCCCATCC
TATGTAGCCAGATTGACGCTACACGAAGCCCAGCTAGCACATGCGCAAAATAGCCACAAGCGAGCTCTGGATTGC
TACCAAATAGCATCCTGGCTATCACGAAAACGCGATTCAAAAATACCTATTTTTCCGCAATATACCAAACCTGCA
ACAAAAAAATATTATAATGGATCTGGACCTTCAACTACCAATGCTGACGATGATGAGATGATTGATGGAGAAGAA
GATACGTGGATTAATGCCGCTGCGCGTGCTGGGGAACTTTGGCTTCGGATAGGATTGTTCAGGCAAAGTTCGTCA
TCAGATATGGGAGAGGAGGAGCGAGAAAAGGAGCTGAATAGGCTGAGAAAAATCGGGGAGAGTGTGACTAAAGAT
TGTCGTGGACTTGGTGGGACGTTGGAAGCGATTGCGGAGGTATTGGAAAGTTGTTTAACAAAGGAGTTTACTACA
GCAAAGACGCACCTCAGACGTGCGATGAATCTGGCAACTAATTCGGGCGATAATCATCTTCGTGCTCTTGTTCTT
TCATTGATTGCTTCGCACTTTTTACACACTTCCTATGACTATGCTGAGAAGATGCTCAAATCATCGGATAGTCTC
GCCGCCGGCTTAGGTTCTCAACCTAAATCATCATCGAAAAAGCAGGACACATTAAACTCACCCGTCAAGGGGGGC
GATCGTGCTGGTGCTCCTAATCTACAACCACTGACAAATGTGGCAGTGGGTAATGCACATCTGAGGTTGTGGATT
GGTGAACGGCGTTTAGAGTTGTACAATAGGATAGGGAATCAGGATGCCGCGAAGATGCAGGTTGGGAGGAATGGT
GCTTTGAAGGAAGCTGTTGCTCGGGTGGAGGCGACGAAATAG
Gene >AgabiH97|000560
ATGGACGACGACGGCGAGCAGAATCCGCGCCCGACAAAACGCCAGAAAACGGAGGACACAATTTCTGCAGAAACA
CCAAAATTGCCACATCTGACCCTCGCCAATCTTCTGCTCAGCCTGCCATCGCTCTTGCTACACCCTCCAACTCAT
ACTAACCATGAACGGTCGCTGGCCTTGTCGTATAATGCACTCAACCGATGTAATGTTCTGACCAGTCTCGATAGA
GTTGTAGAATGTCGCGCAGCTACTGGGTTGGTGGAACTTGGGCTACAGATCGGACTTTCAACTCCTGGCGTACAG
GGCGAGATTCAAAAAGCGCTCACTAAAGCAGTCAGTATATTGCATTTTTTGGATTCATTATATGCTTATGCCCAT
TTGTAGTCTCTCGTAGCACAAAATGTATGCTCCCTCTTCAAGCTGTTCCATGCCCTAGGTCTCACGACGTGGCCC
AGCTTCCCTCGCTTCATCTCTACAGACACCGCATTTCGCAGCTATCCTCGCAGCTCTCCTTGGCTTCCGGAAACC
CAAAAGTCGCCCAAAACAATCTCAAACGGGCCCTATCAACGGTTACTCCAAATGACCCACCGCATATACTCTACT
CTACCCATCTCGCTATCATCGCCAGCATCAGCTCCCAAAGTTCAGACGAAACGACAAATACAATGCGTTCCCTCG
GTGCTATCAGTGACCTACATGAACTCGCCTCGAAGCAAGGTCATCAATCAATGGTCCAGCTTGCCTCAGTCCTGC
GTCTCCGTGCACTTGTGCGTTCTGGACTGTGGGATGACGTTGGAGAGACTTTGGACGCAATTGAAATTAAACTGG
ATATGGCGGTGACATTAAACAATTATTCTATGGATAAAGCAAAAGTCACCGAGGATCAAGGCCAGGCCTCCCTCC
CCTCCCCGCCCTTGACTAACAATTCGCCAAGGTCTACCCTCGAGTATGCGCTAATCATCCATTCCCTTGTCTTGG
GCATTATCTTCTACACCTATACTGGAGACTCTAGTCTCGCTACCCCAAGATTGAAATGGCTCCATGAACTACTTG
ATATTCAGTTACCTCATTTTCCAAAAACTGGTATCTTCGAGGTGAGTATATGCGCTCCCTACGTGTCCTCCGCCT
CTAAAAGTGTCTACAGATCCCATTTTCGAATGGCCCACCCCTCCATTATCAACTGACTCATCCTAGGGTGATATA
TATCCTGGGTTTCCTGGTTTCGAGTCTTGCGAAACGAGATATGATGGGGAGGAAGCCGAAGAAAAAAGTCTTTGC
CAGTGAAGGTATCATCGCGATTGACAAGGAGCTGAGACGGGAAATTGCTGGTACGTTCGAATCACCCGTGATTTC
CTCTATGCATTCATGTATTCCTCCTGCCTCCGCAGTGCCGACCTGGGCTTCAATATCTGATGTTAGAGAGATAGA
TACCCACTTCAAGAAACTTAGGGCTGACCTCATGTGCGAAATCATTGGTGTACGTTTCTAGGTTTATAAAGTTAC
TTCCATTCTGACATCTCGCTAGGCATCTATCATGAGAAGCGAGTTTGATGAAGCGGAGCGTGTATGTCAATTCCC
CCTGCGCCCGAGTCGCTTCATCTCTAATCCAGCCAGTCAATCGACGAACTGATTTCTTATACCCGGACACAAGGA
ATTTTCCCATCCTATGTAGCCAGATTGACGCTACACGAAGCCCAGCTAGCACATGCGCAAAATAGCCACAAGCGA
GCTCTGGATTGCTACCAAATAGCATCCTGGCTATCACGAAAACGCGATTCAAAAATACCTATTTTTCCGCAATAT
ACCAAACCTGCAACAAAAAAATATTATAATGGATCTGGACCTTCAACTACCAATGCTGACGATGATGAGATGATT
GATGGAGAAGAAGATACGTGGATTAATGCCGCTGCGCGTGCTGGGGAACTTTGGCTTCGGATAGGATTGTTCAGG
CAAAGTTCGTCATCAGATATGGGAGAGGAGGAGCGAGAAAAGGAGCTGAATAGGCTGAGAAAAATCGGGGAGAGT
GTGACTAAAGATTGTCGTGGACTTGGTGGGACGTTGGAAGCGATTGCGGAGGTATTGGAAAGTTGTTTAACAAAG
GAGTTTACTACAGCAAAGTATGTCTTCCTTTCTTCCTCTTATCTTCAGCTGACGCGTTTCGTAATAGGACGCACC
TCAGACGTGCGATGAATCTGGCAACTAATTCGGGCGATAATCATCTTCGTGCTCTTGTTCTTTCATTGATTGCTT
CGCACTTTTTACACACTTCCTATGACTATGCTGAGAAGATGCTCAAATCATCGGATAGTCTCGCCGCCGGCTTAG
GTTCTCAACCTAAATCATCATCGAAAAAGCAGGACACATTAAACTCACCCGTCAAGGGGGGCGATCGTGCTGGTG
CTCCTAATCTACAACCACTGACAAATGTGGCAGTGGGTAATGCACATCTGAGGTTGTGGATTGGTGAACGGCGTT
TAGGTGCGACTTTGACCTTTTTGGCCGTTTTTACCTTTGTGCTGACGGTGAGTAGAGTTGTACAATAGGATAGGG
AATCAGGATGCCGCGAAGATGCAGGTTGGGAGGAATGGTGCTTTGAAGGAAGCTGTTGCTCGGGTGGAGGCGACG
AAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail