Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|000550
Gene name
Locationscaffold_1:134882..135570
Strand-
Gene length (bp)688
Transcript length (bp)525
Coding sequence length (bp)525
Protein length (aa) 175

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like 1.7E-08 26 97

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|000550
MLIILLHFFAFTVVTRGAFNAHSSLSGFFWIQNSMTHRVLDVEMGSTEPGANVLLWEPKKAGYDNQLWTYEDEVF
VNKHSNLVLYLPSVGDQVIHGTSLIQAKPINQTDGVDDDEPMERYKRSWGVDPQGRIFSWLDDNFCIAPGEGVSV
VVEDCFFGDVDDMVWRFVPAQPVR*
Coding >AgabiH97|000550
ATGCTCATCATACTGCTTCATTTTTTCGCATTCACGGTCGTAACAAGGGGTGCCTTCAATGCGCATTCTAGTCTT
TCTGGGTTCTTCTGGATTCAGAATTCCATGACTCACAGAGTTCTCGATGTGGAAATGGGAAGTACTGAACCTGGT
GCGAATGTGCTGCTTTGGGAGCCTAAGAAAGCCGGATATGATAACCAATTGTGGACATACGAAGATGAAGTTTTC
GTCAATAAACATTCGAATCTGGTTCTTTATTTACCTTCTGTTGGAGATCAAGTTATCCATGGAACGTCTTTAATA
CAAGCCAAACCTATCAATCAGACAGACGGTGTTGATGACGACGAACCAATGGAACGGTATAAAAGATCATGGGGA
GTTGATCCTCAAGGTCGGATATTTAGTTGGTTGGATGATAATTTTTGTATTGCGCCGGGTGAGGGAGTGAGTGTT
GTTGTTGAGGATTGTTTTTTTGGGGATGTGGATGATATGGTTTGGAGATTTGTTCCTGCTCAACCGGTTAGATAG
Transcript >AgabiH97|000550
ATGCTCATCATACTGCTTCATTTTTTCGCATTCACGGTCGTAACAAGGGGTGCCTTCAATGCGCATTCTAGTCTT
TCTGGGTTCTTCTGGATTCAGAATTCCATGACTCACAGAGTTCTCGATGTGGAAATGGGAAGTACTGAACCTGGT
GCGAATGTGCTGCTTTGGGAGCCTAAGAAAGCCGGATATGATAACCAATTGTGGACATACGAAGATGAAGTTTTC
GTCAATAAACATTCGAATCTGGTTCTTTATTTACCTTCTGTTGGAGATCAAGTTATCCATGGAACGTCTTTAATA
CAAGCCAAACCTATCAATCAGACAGACGGTGTTGATGACGACGAACCAATGGAACGGTATAAAAGATCATGGGGA
GTTGATCCTCAAGGTCGGATATTTAGTTGGTTGGATGATAATTTTTGTATTGCGCCGGGTGAGGGAGTGAGTGTT
GTTGTTGAGGATTGTTTTTTTGGGGATGTGGATGATATGGTTTGGAGATTTGTTCCTGCTCAACCGGTTAGATAG
Gene >AgabiH97|000550
ATGCTCATCATACTGCTTCATTTTTTCGCATTCACGGTCGTAACAAGGGGTGCCTTCAATGCGCATTCTAGTCTT
TCTGGGTTCTTCTGGATTCAGAATTCCATGACTCACAGAGTTCTCGATGTGGAAATGGGAAGTACTGAAGTCAGT
TTTTCAAAATTTTATAACTAGCCTCTTGTCACGAAACGTTATGAAATTCGCTTTTTGATAATTGTAAAAAACTTT
TTTTTTGTTTTGTCTAGCCTGGTGCGAATGTGCTGCTTTGGGAGCCTAAGAAAGCCGGATATGATAACCAATTGT
GGACATACGAAGATGAAGTTTTCGTCAATAAACATTCGAATCTGGTTCTTTATTTACCTTGTGAGTTCTCCTTGT
TGATTACATTCGCGGCATTTTGTCTATCAGAATATCTGATGATTTATCAGCTGTTGGAGATCAAGTTATCCATGG
AACGTCTTTAATACAAGCCAAACCTATCAATCAGACAGACGGTGTTGATGACGACGAACCAATGGAACGGTATAA
AAGATCATGGGGAGTTGATCCTCAAGGTCGGATATTTAGTTGGTTGGATGATAATTTTTGTATTGCGCCGGGTGA
GGGAGTGAGTGTTGTTGTTGAGGATTGTTTTTTTGGGGATGTGGATGATATGGTTTGGAGATTTGTTCCTGCTCA
ACCGGTTAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail