Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|000490
Gene name
Locationscaffold_1:122212..122922
Strand-
Gene length (bp)710
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01929 Ribosomal_L14e Ribosomal protein L14 1.8E-31 49 124
PF00467 KOW KOW motif 1.1E-05 12 42

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38754|RL14B_YEAST 60S ribosomal protein L14-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL14B PE=1 SV=1 4 134 5.0E-36
sp|O94238|RL14_SCHPO 60S ribosomal protein L14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl14 PE=2 SV=1 6 134 7.0E-36
sp|P36105|RL14A_YEAST 60S ribosomal protein L14-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL14A PE=1 SV=1 4 134 3.0E-35
sp|O46160|RL14_LUMRU 60S ribosomal protein L14 OS=Lumbricus rubellus GN=RPL14 PE=3 SV=1 5 136 4.0E-32
sp|Q63507|RL14_RAT 60S ribosomal protein L14 OS=Rattus norvegicus GN=Rpl14 PE=1 SV=3 6 133 2.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38754|RL14B_YEAST 60S ribosomal protein L14-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL14B PE=1 SV=1 4 134 5.0E-36
sp|O94238|RL14_SCHPO 60S ribosomal protein L14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl14 PE=2 SV=1 6 134 7.0E-36
sp|P36105|RL14A_YEAST 60S ribosomal protein L14-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL14A PE=1 SV=1 4 134 3.0E-35
sp|O46160|RL14_LUMRU 60S ribosomal protein L14 OS=Lumbricus rubellus GN=RPL14 PE=3 SV=1 5 136 4.0E-32
sp|Q63507|RL14_RAT 60S ribosomal protein L14 OS=Rattus norvegicus GN=Rpl14 PE=1 SV=3 6 133 2.0E-30
sp|P50914|RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens GN=RPL14 PE=1 SV=4 6 133 3.0E-30
sp|Q3T0U2|RL14_BOVIN 60S ribosomal protein L14 OS=Bos taurus GN=RPL14 PE=2 SV=3 6 133 6.0E-30
sp|Q9CR57|RL14_MOUSE 60S ribosomal protein L14 OS=Mus musculus GN=Rpl14 PE=1 SV=3 6 133 7.0E-30
sp|A1XQU3|RL14_PIG 60S ribosomal protein L14 OS=Sus scrofa GN=RPL14 PE=1 SV=1 6 133 8.0E-30
sp|P55841|RL14_DROME 60S ribosomal protein L14 OS=Drosophila melanogaster GN=RpL14 PE=1 SV=1 6 127 5.0E-26
sp|Q9SIM4|RL141_ARATH 60S ribosomal protein L14-1 OS=Arabidopsis thaliana GN=RPL14A PE=2 SV=1 6 133 5.0E-25
sp|Q95ZE8|RL14_DROVI 60S ribosomal protein L14 OS=Drosophila virilis GN=RpL14 PE=3 SV=1 6 127 8.0E-25
sp|Q9T043|RL142_ARATH 60S ribosomal protein L14-2 OS=Arabidopsis thaliana GN=RPL14B PE=2 SV=1 6 133 3.0E-24
sp|P55844|RL14_PEA Probable 60S ribosomal protein L14 OS=Pisum sativum PE=2 SV=1 6 133 1.0E-23
sp|Q7XYA7|RL14_GRIJA 60S ribosomal protein L14 OS=Griffithsia japonica GN=RPL14 PE=2 SV=1 5 136 7.0E-23
sp|Q24C27|RL14_TETTS 60S ribosomal protein L14 OS=Tetrahymena thermophila (strain SB210) GN=RPL14 PE=1 SV=2 6 122 6.0E-21
sp|Q54Z09|RL14_DICDI 60S ribosomal protein L14 OS=Dictyostelium discoideum GN=rpl14 PE=3 SV=1 4 133 3.0E-15
sp|Q8TX43|RL14E_METKA 50S ribosomal protein L14e OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl14e PE=3 SV=1 10 88 6.0E-07
sp|P55842|RL14_TRYBB Probable 60S ribosomal protein L14 OS=Trypanosoma brucei brucei PE=1 SV=1 9 129 3.0E-06
sp|A2BME7|RL14E_HYPBU 50S ribosomal protein L14e OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl14e PE=3 SV=1 10 88 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:1901576 organic substance biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0043229 intracellular organelle No
GO:0019538 protein metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0008150 biological_process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0071704 organic substance metabolic process No
GO:0043043 peptide biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0009058 biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0008152 metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006518 peptide metabolic process No
GO:0043226 organelle No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005198 structural molecule activity No
GO:0009059 macromolecule biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5864 0.2813 0.0093 0.0515 0.5068 0.0264 0.1298 0.0303 0.003 0.003

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup3002
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|000490
Agaricus bisporus var bisporus H97 AgabiH97|000490 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|34_49

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|000490
MPESNFKRFVEVGRVVLVNDGPLAGKIAVIAEIIDHNRAIIDGPTSGIPRQSFPYKHLLLTPLKLTKLPRAAGTG
IVRKLVEQEGIVEKWDKSAWAQKRVMKEKRRSLSDFGRFKVMLAKKQRRDVVRKAVKKASA*
Coding >AgabiH97|000490
ATGCCAGAATCAAATTTCAAGCGCTTTGTCGAGGTTGGTCGAGTTGTCCTCGTGAACGACGGTCCTCTTGCGGGA
AAAATTGCCGTCATTGCAGAGATTATCGACCACAATAGGGCAATCATCGATGGTCCTACGAGTGGTATTCCCCGC
CAATCCTTCCCCTACAAACACCTTCTTCTCACCCCTCTAAAACTCACAAAACTTCCCCGTGCTGCAGGAACCGGA
ATTGTAAGAAAATTGGTGGAACAGGAGGGTATTGTAGAGAAATGGGACAAGTCTGCGTGGGCGCAAAAACGGGTG
ATGAAGGAGAAGCGGAGGTCACTGAGTGACTTTGGCCGATTCAAAGTCATGCTGGCGAAGAAACAGAGACGGGAT
GTCGTCAGAAAAGCCGTCAAGAAGGCATCAGCCTAA
Transcript >AgabiH97|000490
ATGCCAGAATCAAATTTCAAGCGCTTTGTCGAGGTTGGTCGAGTTGTCCTCGTGAACGACGGTCCTCTTGCGGGA
AAAATTGCCGTCATTGCAGAGATTATCGACCACAATAGGGCAATCATCGATGGTCCTACGAGTGGTATTCCCCGC
CAATCCTTCCCCTACAAACACCTTCTTCTCACCCCTCTAAAACTCACAAAACTTCCCCGTGCTGCAGGAACCGGA
ATTGTAAGAAAATTGGTGGAACAGGAGGGTATTGTAGAGAAATGGGACAAGTCTGCGTGGGCGCAAAAACGGGTG
ATGAAGGAGAAGCGGAGGTCACTGAGTGACTTTGGCCGATTCAAAGTCATGCTGGCGAAGAAACAGAGACGGGAT
GTCGTCAGAAAAGCCGTCAAGAAGGCATCAGCCTAA
Gene >AgabiH97|000490
ATGCCAGTACGTTCGGAATTTCTGTTCAGACAGTGACTAGGTCGCATGCAGCTACGCACAGTTGGAACTTTGGGC
AAAAATCAGTTGGATGAGAGTTTGGGTCACCAGATGACGGGTTTGGCTTATCGCTGAGCTGCATGCGACCTAAAC
AATAGCGGAAGGCATCTTTGAATTGACAAAGGTTTATCTTGTCTCTAGGAATCAAATTTCAAGCGCTTTGTCGAG
GTTGGTCGAGGTGTGTATCGTCCACTTTCGAGGCATTCCAGATCTTAGCTGACGACGCTTCGTAGTTGTCCTCGT
GAACGACGGTCCTCTTGCGGGAAAAATTGCCGTCATTGCAGAGATTATCGACCACAATAGGGTGAGATAAATCTA
TATCATTATTGTTGGCATAGAAGTTTACATTCACGTAGGCAATCATCGATGGTCCTACGAGTGGTATTCCCCGCC
AATCCTTCCCCTACAAACACCTTCTTCTCACCCCTCTAAAACTCACAAAACTTCCCCGTGCTGCAGGAACCGGAA
TTGTAAGAAAATTGGTGGAACAGGAGGGTATTGTAGAGAAATGGGACAAGTCTGCGTGGGCGCAAAAACGGGTGA
TGAAGGAGAAGCGGAGGTCACTGAGTGACTTTGGCCGATTCAAAGTCATGCTGGCGAAGAAACAGAGACGGGATG
TCGTCAGAAAAGCCGTCAAGAAGGCATCAGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail