Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|000340
Gene name
Locationscaffold_1:77248..78741
Strand-
Gene length (bp)1493
Transcript length (bp)978
Coding sequence length (bp)978
Protein length (aa) 326

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 5.4E-20 100 239

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 18 256 1.0E-15
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 34 284 2.0E-15
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 34 284 2.0E-15
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 2 255 2.0E-14
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 89 257 3.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 18 256 1.0E-15
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 34 284 2.0E-15
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 34 284 2.0E-15
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 2 255 2.0E-14
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 89 257 3.0E-13
sp|P61870|MDLA_PENCA Mono- and diacylglycerol lipase OS=Penicillium camembertii GN=mdlA PE=1 SV=1 89 257 3.0E-13
sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 139 272 4.0E-08
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 139 272 5.0E-08
sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 139 272 8.0E-08
sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 139 272 9.0E-08
sp|A2ZW16|PLA1_ORYSJ Phospholipase A1-II 1 OS=Oryza sativa subsp. japonica GN=Os01g0651100 PE=3 SV=2 97 264 1.0E-07
sp|A2WT95|PLA1_ORYSI Phospholipase A1-II 1 OS=Oryza sativa subsp. indica GN=OsI_03083 PE=3 SV=2 97 264 1.0E-07
sp|Q941F1|PLA15_ARATH Phospholipase A1-Igamma1, chloroplastic OS=Arabidopsis thaliana GN=At1g06800 PE=1 SV=2 150 258 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|000340
MLLSSILIVFWALTSANAGTIAGEYRRATIEELTPVQISQFTPFTRFASAAYCSLEAMSLWTCGADCETNSDFIP
TATGGDGGFVQRWYVGYSPSLQSVVVAHQGTDPVRIEAIIADVAFVPTVLNPDLFPGVTFPVLVHGGFALQHARA
AKAILSAVKITIARHNTTKVALVGHSLGGALALLDSVYLPLHIKGVEFRTVVYGLPRVGNVAFANYVDKHTSLTR
INNKRDPIPTTPLQLLGYRHPSGEVHITGGNKWLTCPGQENPSFQCTFGSVPLFLDVDEVDKMLTVPRQIVSVCP
LTERREERQRVGYRTLTMRRKPYPG*
Coding >AgabiH97|000340
ATGCTGCTTTCTAGCATTCTTATCGTTTTCTGGGCTTTGACCTCTGCCAATGCTGGCACGATAGCGGGAGAATAT
AGACGAGCGACCATCGAGGAATTGACACCCGTGCAAATTTCCCAATTTACCCCTTTCACTCGGTTTGCAAGTGCT
GCATATTGCTCTCTTGAGGCCATGTCATTATGGACTTGTGGAGCTGATTGTGAAACTAATTCTGATTTCATACCT
ACCGCTACGGGTGGGGATGGTGGATTCGTTCAACGATGGTACGTTGGATATTCACCGTCTCTACAATCAGTCGTG
GTGGCCCATCAGGGTACTGATCCAGTGAGAATCGAGGCGATTATTGCGGACGTTGCTTTCGTACCTACGGTACTC
AATCCGGACCTTTTTCCCGGGGTCACTTTCCCAGTATTAGTGCATGGTGGTTTTGCTTTGCAGCATGCCAGGGCC
GCGAAAGCGATTTTGTCGGCCGTTAAGATCACCATCGCAAGGCACAATACAACCAAAGTGGCGCTAGTTGGTCAC
TCACTTGGTGGTGCCCTTGCTTTACTTGATAGTGTGTATCTTCCCCTTCACATCAAAGGCGTCGAATTCCGTACA
GTCGTATATGGTCTACCAAGGGTAGGGAACGTCGCGTTCGCGAATTACGTGGATAAACACACATCTCTCACCCGG
ATAAACAACAAAAGAGATCCTATTCCCACTACTCCACTTCAACTTTTGGGCTATCGCCACCCTTCTGGCGAGGTT
CATATTACGGGAGGAAATAAATGGCTTACTTGTCCCGGACAGGAGAACCCGAGTTTTCAATGCACTTTCGGGAGT
GTGCCGTTATTTCTTGATGTTGACGAAGTAGACAAAATGTTAACGGTTCCACGGCAAATTGTTTCGGTCTGTCCC
TTAACGGAGAGACGTGAAGAAAGGCAGAGGGTAGGATACAGGACCTTAACAATGCGACGCAAACCATACCCTGGG
TAA
Transcript >AgabiH97|000340
ATGCTGCTTTCTAGCATTCTTATCGTTTTCTGGGCTTTGACCTCTGCCAATGCTGGCACGATAGCGGGAGAATAT
AGACGAGCGACCATCGAGGAATTGACACCCGTGCAAATTTCCCAATTTACCCCTTTCACTCGGTTTGCAAGTGCT
GCATATTGCTCTCTTGAGGCCATGTCATTATGGACTTGTGGAGCTGATTGTGAAACTAATTCTGATTTCATACCT
ACCGCTACGGGTGGGGATGGTGGATTCGTTCAACGATGGTACGTTGGATATTCACCGTCTCTACAATCAGTCGTG
GTGGCCCATCAGGGTACTGATCCAGTGAGAATCGAGGCGATTATTGCGGACGTTGCTTTCGTACCTACGGTACTC
AATCCGGACCTTTTTCCCGGGGTCACTTTCCCAGTATTAGTGCATGGTGGTTTTGCTTTGCAGCATGCCAGGGCC
GCGAAAGCGATTTTGTCGGCCGTTAAGATCACCATCGCAAGGCACAATACAACCAAAGTGGCGCTAGTTGGTCAC
TCACTTGGTGGTGCCCTTGCTTTACTTGATAGTGTGTATCTTCCCCTTCACATCAAAGGCGTCGAATTCCGTACA
GTCGTATATGGTCTACCAAGGGTAGGGAACGTCGCGTTCGCGAATTACGTGGATAAACACACATCTCTCACCCGG
ATAAACAACAAAAGAGATCCTATTCCCACTACTCCACTTCAACTTTTGGGCTATCGCCACCCTTCTGGCGAGGTT
CATATTACGGGAGGAAATAAATGGCTTACTTGTCCCGGACAGGAGAACCCGAGTTTTCAATGCACTTTCGGGAGT
GTGCCGTTATTTCTTGATGTTGACGAAGTAGACAAAATGTTAACGGTTCCACGGCAAATTGTTTCGGTCTGTCCC
TTAACGGAGAGACGTGAAGAAAGGCAGAGGGTAGGATACAGGACCTTAACAATGCGACGCAAACCATACCCTGGG
TAA
Gene >AgabiH97|000340
ATGCTGCTTTCTAGCATTCTTATCGTTTTCTGGGCTTTGACCTCTGCCAATGCTGGCACGATAGCGGGAGAATAT
AGACGAGCGACCATCGAGGAATTGACACCCGTGCAAATTTCCCAATTTACCCCTTTCACTCGGTTTGCAAGTGCT
GCATATTGCTCTCTTGAGGCCATGTCATTATGGACTTGTGGAGGTGACTTTTTCTAGGTCCACGTCTGTCATTTA
CATCTGCTCAAATTCAATACTTGCTAGCTGATTGTGAAACTAATTCTGATTTCATACCTACCGCTACGGGTGGGG
ATGGTGGATTCGTTCAACGATGTACGTACGCCGCCTCTGGCATTTTTTAAATTTTATTTTTGTCTATATTGGATA
CTCAATAACATCAGGGTACGTTGGATATTCACCGTCTCTACAATCAGTCGTGGTGGCCCATCAGGGTACTGATCC
AGTGAGAATGTTCGTATACTATACAGATTGCATATCTTTCGTGTCATTCATTCAAGAATTACCCAGCGAGGCGAT
TATTGCGGACGTTGCTTTCGTACCTACGGTACTCAATCCGGACCTTTTTCCCGGGGTCACTTTCCCAGTATTAGT
GCATGGTGGTTTTGCTTTGCAGCATGCCAGGTAAGTTCATCTTCGATTCGCTCCTTCTGTTATCATTGTAGGCCT
GAGGGAAATATTAGGGCCGCGAAAGCGATTTTGTCGGCCGTTAAGATCACCATCGCAAGGCACAATACAACCAAA
GTGGCGCTAGTTGGTCACTCACTTGGTGGTGCCCTTGCTTTACTTGATAGTGTGTATCTTCCCCTTCACATCAAA
GGCGTCGAATTCCGTACAGTCGTATATGGTCTACCAAGGGTAAAACCCTCTCCTCTTTTGTAACAATGTCCTTTG
TGCTAATATAGACGGATATCGTAGGTAGGGAACGTCGCGTTCGCGAATTACGTGGATAAACACACATCTCTCACC
CGGATAAACAACAAAAGAGATCCTATTCCCACTACTCCACGTGAGTATCAGTATGAAAGTTATAGCAACGGTTTT
CCTTCATTTTGCATCTAGTTCAACTTTTGGGCTATCGCCACCCTTCTGGCGAGGTTCATATTACGGGAGGAAATA
AATGGCTTACTTGTCCCGGACAGGAGAACCCGAGTTTTCAATGCACTTTCGGGAGTGTGCCGTTATTTCTTGTAG
GTAATCCTCTTGACCACCACGGTTCTTACAACGGTGTCAACATGGGCGAAGGATGTTGACGAAGTAGACAAAATG
TTCCTCTAGTGTTTACTGCCCTTAGATACTAGTTGATGGCAATGGTCAAGGTTAACGGTTCCACGGCAAATTGTT
TCGGTCTGTCCCTTAACGGAGAGACGTGAAGAAAGGCAGAGGGTAGGATACAGGACCTTGTGAGTGAAGTGAAAC
TATGGAAACGAAAGCAGTCGATTGATGCTCCAGTTAGAACAATGCGACGCAAACCATACCCTGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail