Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|000330
Gene name
Locationscaffold_1:76273..77024
Strand+
Gene length (bp)751
Transcript length (bp)600
Coding sequence length (bp)600
Protein length (aa) 200

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15370 NOPCHAP1 NOP protein chaperone 1 4.2E-19 58 146

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0000492 box C/D snoRNP assembly Yes
GO:0065003 protein-containing complex assembly No
GO:0022607 cellular component assembly No
GO:0022618 ribonucleoprotein complex assembly No
GO:0016043 cellular component organization No
GO:0000491 small nucleolar ribonucleoprotein complex assembly No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0043933 protein-containing complex organization No
GO:0071826 ribonucleoprotein complex subunit organization No
GO:0071840 cellular component organization or biogenesis No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|000330
MNTDHNNVLDVEDDDQRQARIQALLENLNSDARPQPPPGLQFDFGNKPPFDVNPPAELLSRVQAFLPQIQASNEA
LTQRMQKDPDSVNIEHVSEHMDQYIQMNLGLGVFEDRSKKSHDAQDTEAQDTEMSSASSSLSSEDADNDSDLDSD
ASSEIITSFVPERIIRPLPRRPLNKTRSSVAIPPERSEGSPSGASQTQA*
Coding >AgabiH97|000330
ATGAACACCGACCACAACAATGTCCTCGACGTCGAGGACGACGACCAGAGGCAGGCTCGCATTCAGGCTCTACTG
GAGAACCTAAACAGCGACGCCAGGCCTCAGCCACCGCCCGGCTTACAGTTCGACTTCGGAAATAAACCCCCTTTT
GACGTCAATCCTCCTGCTGAGCTATTGTCCCGGGTTCAGGCGTTTCTTCCCCAGATCCAGGCATCCAATGAAGCT
CTTACTCAGCGTATGCAGAAGGACCCAGACAGTGTCAATATCGAGCATGTCAGTGAGCATATGGACCAGTACATT
CAAATGAATCTTGGTCTTGGTGTCTTTGAAGATCGTAGCAAGAAGTCACACGACGCTCAAGACACGGAAGCTCAA
GACACGGAAATGTCATCGGCCTCTTCTTCGCTCTCTTCAGAAGATGCCGATAACGACTCTGATCTTGACTCGGAT
GCGTCATCTGAAATTATCACCTCTTTCGTCCCTGAGCGGATCATCAGACCTCTTCCTAGACGTCCCCTCAATAAG
ACACGTTCTTCAGTCGCTATCCCGCCCGAGAGATCAGAGGGGTCACCTTCTGGCGCCTCACAAACTCAAGCCTGA
Transcript >AgabiH97|000330
ATGAACACCGACCACAACAATGTCCTCGACGTCGAGGACGACGACCAGAGGCAGGCTCGCATTCAGGCTCTACTG
GAGAACCTAAACAGCGACGCCAGGCCTCAGCCACCGCCCGGCTTACAGTTCGACTTCGGAAATAAACCCCCTTTT
GACGTCAATCCTCCTGCTGAGCTATTGTCCCGGGTTCAGGCGTTTCTTCCCCAGATCCAGGCATCCAATGAAGCT
CTTACTCAGCGTATGCAGAAGGACCCAGACAGTGTCAATATCGAGCATGTCAGTGAGCATATGGACCAGTACATT
CAAATGAATCTTGGTCTTGGTGTCTTTGAAGATCGTAGCAAGAAGTCACACGACGCTCAAGACACGGAAGCTCAA
GACACGGAAATGTCATCGGCCTCTTCTTCGCTCTCTTCAGAAGATGCCGATAACGACTCTGATCTTGACTCGGAT
GCGTCATCTGAAATTATCACCTCTTTCGTCCCTGAGCGGATCATCAGACCTCTTCCTAGACGTCCCCTCAATAAG
ACACGTTCTTCAGTCGCTATCCCGCCCGAGAGATCAGAGGGGTCACCTTCTGGCGCCTCACAAACTCAAGCCTGA
Gene >AgabiH97|000330
ATGAACACCGACCACAACAATGTCCTCGACGTCGAGGACGACGACCAGAGGCAGGCTCGCATTCGTAAGTCTGGG
CCCTGTACTGATGCTGCATTAATGTCTGTTATCCAGAGGCTCTACTGGAGAACCTAAACAGCGACGCCAGGCCTC
AGCCACCGCCCGGCTTACAGTTCGACTTCGGAAATAAACCCCCTTTTGACGTCAATCCTCCTGCTGAGCGTCTGT
ACCACCCAGCTCTAGCGCTCCTGTATCGTCATTCAACAGTTTTACCCAGTATTGTCCCGGGTTCAGGCGTTTCTT
CCCCAGATCCAGGCATCCAATGAAGCTCTTACTCAGCGTATGCAGAAGGACCCAGACAGTGTCAATATCGAGCAT
GTCAGTGAGCATATGGACCAGTACATTCAAATGGTGTGTCATTTCATCTCTCAACATCAGTGCTTCTCATTCGTT
GCCGCAGAATCTTGGTCTTGGTGTCTTTGAAGATCGTAGCAAGAAGTCACACGACGCTCAAGACACGGAAGCTCA
AGACACGGAAATGTCATCGGCCTCTTCTTCGCTCTCTTCAGAAGATGCCGATAACGACTCTGATCTTGACTCGGA
TGCGTCATCTGAAATTATCACCTCTTTCGTCCCTGAGCGGATCATCAGACCTCTTCCTAGACGTCCCCTCAATAA
GACACGTTCTTCAGTCGCTATCCCGCCCGAGAGATCAGAGGGGTCACCTTCTGGCGCCTCACAAACTCAAGCCTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail