Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|000090
Gene name
Locationscaffold_1:21146..22875
Strand-
Gene length (bp)1729
Transcript length (bp)1299
Coding sequence length (bp)1299
Protein length (aa) 433

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 9.9E-17 73 204

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 16 316 2.0E-38
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 13 328 1.0E-34
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 79 261 3.0E-12
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 40 301 4.0E-11
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 135 311 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 16 316 2.0E-38
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 13 328 1.0E-34
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 79 261 3.0E-12
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 40 301 4.0E-11
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 135 311 2.0E-10
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 97 234 4.0E-10
sp|Q9LTS3|CKX3_ARATH Cytokinin dehydrogenase 3 OS=Arabidopsis thaliana GN=CKX3 PE=1 SV=1 57 232 1.0E-08
sp|Q9FUJ1|CKX7_ARATH Cytokinin dehydrogenase 7 OS=Arabidopsis thaliana GN=CKX7 PE=1 SV=1 73 239 3.0E-08
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 98 231 6.0E-07
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 77 217 6.0E-06
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 51 236 8.0E-06
sp|A3AVP1|CKX8_ORYSJ Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. japonica GN=CKX8 PE=3 SV=1 168 231 9.0E-06
sp|A2XVN3|CKX8_ORYSI Cytokinin dehydrogenase 8 OS=Oryza sativa subsp. indica GN=CKX8 PE=3 SV=1 168 231 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|000090
MMLLTRFPVFTLAVLSLFPYASWGNSDHEKAVAACAVLKQQIPHAVHFPGTSEYLQDIGHYVEVAGQNSTCGVAP
MTPEEVQMIVKVLGRDDIRSPFAVKSGGHVFNPGFSSTFGVQVSLQNLLDFDYNEDAQTVKLGSGWTWDAIYEML
QPKNVTVVGGRIPGVGLGLLYGGGLSWYTNQHGLASDNVVEFDLVLPNGTFVNVTETSQPDLYFGLRGGLNNFGI
ITSVTVKTWPTGDIWGGTIAYSIEHNDEIMKAVEEFSVENTDVKAQLQAVYTLTKEKAFWQIIFFYDAPDSSPAP
FKAFLSIPSTSDTTEVTTHSQFVKNTPFPPVVGSYLHTVPVLQYTVPVLQAVETSVNASFAKALKDERSAATFYW
FAEPFYNQNSHSTFPSAFPHSPSNPITPSCFWYNYTSPDDVEYFRQSIKDVGTELQT*
Coding >AgabiH97|000090
ATGATGCTTCTCACTCGATTCCCCGTTTTCACGCTAGCTGTTCTTTCGCTCTTCCCTTACGCATCATGGGGAAAT
AGCGATCACGAGAAGGCTGTGGCAGCGTGTGCCGTATTGAAACAACAGATTCCTCACGCCGTACATTTCCCAGGA
ACTTCGGAATATCTGCAAGATATAGGGCACTATGTGGAAGTGGCAGGACAGAACTCAACATGCGGAGTTGCACCA
ATGACTCCCGAGGAAGTTCAGATGATTGTAAAAGTACTTGGCAGAGATGACATTCGTTCTCCATTTGCTGTCAAG
TCTGGTGGACATGTATTTAACCCTGGATTTTCATCTACGTTTGGGGTTCAGGTCTCGCTGCAGAATCTTCTCGAT
TTTGATTATAATGAAGACGCCCAAACAGTGAAATTAGGATCAGGGTGGACGTGGGATGCGATATATGAAATGCTT
CAACCAAAGAATGTCACAGTAGTTGGAGGAAGAATTCCCGGTGTCGGACTCGGTCTTCTTTATGGCGGCGGGCTT
TCCTGGTATACCAATCAGCATGGTTTAGCCTCCGACAACGTGGTCGAATTCGACTTAGTGTTGCCAAACGGGACT
TTTGTCAACGTCACCGAAACATCTCAGCCTGATTTATATTTTGGGCTCCGAGGTGGTTTGAATAACTTTGGGATC
ATCACAAGTGTTACAGTAAAGACGTGGCCTACAGGCGATATTTGGGGGGGAACGATTGCATACTCGATCGAGCAC
AATGATGAAATCATGAAAGCCGTCGAGGAATTCAGCGTAGAAAATACGGATGTGAAAGCTCAATTGCAAGCTGTT
TATACGCTAACCAAAGAGAAGGCGTTTTGGCAAATCATATTTTTCTACGATGCGCCTGATTCGTCACCGGCTCCA
TTCAAAGCATTCCTTTCTATCCCATCGACTAGTGATACCACTGAAGTCACTACTCACAGTCAATTCGTGAAGAAC
ACTCCTTTCCCTCCTGTAGTCGGATCATATCTTCACACAGTACCCGTCCTCCAATATACCGTTCCGGTCCTTCAA
GCTGTCGAAACATCAGTAAACGCCTCCTTCGCTAAAGCCCTCAAAGATGAACGATCAGCAGCAACTTTTTATTGG
TTCGCTGAACCGTTCTACAATCAAAATTCACATTCTACTTTCCCATCCGCGTTCCCTCATTCCCCGTCCAACCCA
ATAACACCGTCATGCTTCTGGTATAACTATACATCGCCTGATGACGTCGAATATTTCAGACAATCGATCAAGGAT
GTTGGGACAGAGTTGCAGACGTAA
Transcript >AgabiH97|000090
ATGATGCTTCTCACTCGATTCCCCGTTTTCACGCTAGCTGTTCTTTCGCTCTTCCCTTACGCATCATGGGGAAAT
AGCGATCACGAGAAGGCTGTGGCAGCGTGTGCCGTATTGAAACAACAGATTCCTCACGCCGTACATTTCCCAGGA
ACTTCGGAATATCTGCAAGATATAGGGCACTATGTGGAAGTGGCAGGACAGAACTCAACATGCGGAGTTGCACCA
ATGACTCCCGAGGAAGTTCAGATGATTGTAAAAGTACTTGGCAGAGATGACATTCGTTCTCCATTTGCTGTCAAG
TCTGGTGGACATGTATTTAACCCTGGATTTTCATCTACGTTTGGGGTTCAGGTCTCGCTGCAGAATCTTCTCGAT
TTTGATTATAATGAAGACGCCCAAACAGTGAAATTAGGATCAGGGTGGACGTGGGATGCGATATATGAAATGCTT
CAACCAAAGAATGTCACAGTAGTTGGAGGAAGAATTCCCGGTGTCGGACTCGGTCTTCTTTATGGCGGCGGGCTT
TCCTGGTATACCAATCAGCATGGTTTAGCCTCCGACAACGTGGTCGAATTCGACTTAGTGTTGCCAAACGGGACT
TTTGTCAACGTCACCGAAACATCTCAGCCTGATTTATATTTTGGGCTCCGAGGTGGTTTGAATAACTTTGGGATC
ATCACAAGTGTTACAGTAAAGACGTGGCCTACAGGCGATATTTGGGGGGGAACGATTGCATACTCGATCGAGCAC
AATGATGAAATCATGAAAGCCGTCGAGGAATTCAGCGTAGAAAATACGGATGTGAAAGCTCAATTGCAAGCTGTT
TATACGCTAACCAAAGAGAAGGCGTTTTGGCAAATCATATTTTTCTACGATGCGCCTGATTCGTCACCGGCTCCA
TTCAAAGCATTCCTTTCTATCCCATCGACTAGTGATACCACTGAAGTCACTACTCACAGTCAATTCGTGAAGAAC
ACTCCTTTCCCTCCTGTAGTCGGATCATATCTTCACACAGTACCCGTCCTCCAATATACCGTTCCGGTCCTTCAA
GCTGTCGAAACATCAGTAAACGCCTCCTTCGCTAAAGCCCTCAAAGATGAACGATCAGCAGCAACTTTTTATTGG
TTCGCTGAACCGTTCTACAATCAAAATTCACATTCTACTTTCCCATCCGCGTTCCCTCATTCCCCGTCCAACCCA
ATAACACCGTCATGCTTCTGGTATAACTATACATCGCCTGATGACGTCGAATATTTCAGACAATCGATCAAGGAT
GTTGGGACAGAGTTGCAGACGTAA
Gene >AgabiH97|000090
ATGATGCTTCTCACTCGATTCCCCGTTTTCACGCTAGCTGTTCTTTCGCTCTTCCCTTACGCATCATGGGGAAAT
AGCGATCACGAGAAGGCTGTGGCAGCGTGTGCCGTATTGAAACAACAGATTCCTCACGCCGTACATTTCCCAGGT
ATGTGCCCTACCTATTTCCTCGAAACGTTTCTAAAAAATTACCTTTAATCAGGAACTTCGGAATATCTGCAAGAT
ATAGGGCACTATGTGGAAGTGGCAGGACAGAACTCAACATGCGGAGTTGCACCAATGACTCCCGAGGAAGTTCAG
ATGATTGTATGTTTTCGTTGAATTCTCGACGATTCACTACAACTTTGGCGATACTTTCAGGTAAAAGTACTTGGC
AGAGATGACATTCGTTCTCCATTTGCTGTACGTCTCCTGATTTATTTTTGTTGTCGCCCTACTCATTCGGGATAA
CAACCTAGGTCAAGTCTGGTGGACATGTATTTAACCCTGGATTTTCATCTACGTTTGGGGTTCAGGTCTCGCTGC
AGAATCTTCTCGATTTTGATTATAATGAAGACGCCCAAACAGTGAAATTAGGATCAGGGTGGACGTGGGATGCGA
TATATGAAATGCTTCAACCAAAGAATGTCACAGTAGTTGGAGGAAGAATTCCCGGTGTCGGTATGTCTTCCTTCG
GCGTTGACGAACTGCCAGGATGCTTAATGTATGCTTAGGACTCGGTCTTCTTTATGGCGGCGGGCTTTCCTGGTA
TACCAATCAGCATGGTTTAGCCTCCGACAACGTGGTCGAATTCGACTTAGTGTTGCCAAACGGGACTTTTGTCAA
CGTCACCGAAACATCTCAGCCTGATTTATATTTTGGGCTCCGAGGTGGTTTGAATAACTTTGGGATCATCACAAG
TGTTACAGTAAAGACGTGGCCTACAGGCGATATTTGGGTGAACTTCTATCTTTCATTTGGAAGCAATCCAAGGTA
ACAATTCTTTGCAGGGGGGAACGATTGCATACTCGATCGAGCACAATGATGAAATCATGAAAGCCGTCGAGGAAT
TCAGCGTAGAAAATACGGATGTGAAAGCTCAATTGCAAGCTGTTTATACGCTAACCAAAGAGAAGGTTTGCTATT
TTCAAGTATCACAATGGTTATTTTTGACATCGTGCACAGGCGTTTTGGCAAATCATATTTTTCTACGATGCGCCT
GATTCGTCACCGGCTCCATTCAAAGCATTCCTTTCTATCCCATCGACTAGTGATACCACTGAAGTCACTACTCAC
AGTCAATTCGTGAAGAACACTCCTTTCCCTCCGTGAGCAGTGCCTTCATTCCCTGATGTATCTTGTTTCACATTT
ACTCTCCTCAGTGTAGTCGGATCATATCTTCACACAGTACCCGTCCTCCAATATACCGTTCCGGTCCTTCAAGCT
GTCGAAACATCAGTAAACGCCTCCTTCGCTAAAGCCCTCAAAGATGAACGATCAGCAGCAACTTTTTATTGGTTC
GCTGAACCGTTCTACAATCAAAATTCACATTCTACTTTCCCATCCGCGTTCCCTCATTCCCCGTCCAACCCAATA
ACACCGTCATGCTTCTGGTATAACTATACATCGCCTGATGACGTCGAATATTTCAGACAATCGATCAAGGATGTT
GGGACAGAGTTGCAGACGGTTGTTGTAGAGGAAGGTCAAGGTCGTTGGGATGATGTCAAATATTCGAATTATGCA
GTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail