Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|552300
Gene name
Locationscaffold_13:1284500..1286992
Strand+
Gene length (bp)2492
Transcript length (bp)2022
Coding sequence length (bp)2022
Protein length (aa) 674

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 8.2E-93 102 552

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7D7|LCF2_SCHPO Long-chain-fatty-acid--CoA ligase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf2 PE=3 SV=1 24 658 8.0E-174
sp|P47912|LCF4_YEAST Long-chain-fatty-acid--CoA ligase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA4 PE=1 SV=1 19 655 5.0E-158
sp|O60135|LCF1_SCHPO Long-chain-fatty-acid--CoA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf1 PE=3 SV=1 15 655 9.0E-156
sp|P30624|LCF1_YEAST Long-chain-fatty-acid--CoA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA1 PE=1 SV=1 22 657 9.0E-156
sp|P39002|LCF3_YEAST Long-chain-fatty-acid--CoA ligase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA3 PE=1 SV=1 22 655 7.0E-152
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7D7|LCF2_SCHPO Long-chain-fatty-acid--CoA ligase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf2 PE=3 SV=1 24 658 8.0E-174
sp|P47912|LCF4_YEAST Long-chain-fatty-acid--CoA ligase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA4 PE=1 SV=1 19 655 5.0E-158
sp|O60135|LCF1_SCHPO Long-chain-fatty-acid--CoA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcf1 PE=3 SV=1 15 655 9.0E-156
sp|P30624|LCF1_YEAST Long-chain-fatty-acid--CoA ligase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA1 PE=1 SV=1 22 657 9.0E-156
sp|P39002|LCF3_YEAST Long-chain-fatty-acid--CoA ligase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA3 PE=1 SV=1 22 655 7.0E-152
sp|Q9SJD4|LACS8_ARATH Long chain acyl-CoA synthetase 8 OS=Arabidopsis thaliana GN=LACS8 PE=1 SV=1 37 667 2.0E-104
sp|Q9CAP8|LACS9_ARATH Long chain acyl-CoA synthetase 9, chloroplastic OS=Arabidopsis thaliana GN=LACS9 PE=1 SV=1 13 655 2.0E-96
sp|O60488|ACSL4_HUMAN Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens GN=ACSL4 PE=1 SV=2 16 654 2.0E-96
sp|O35547|ACSL4_RAT Long-chain-fatty-acid--CoA ligase 4 OS=Rattus norvegicus GN=Acsl4 PE=1 SV=1 16 654 3.0E-94
sp|Q9QUJ7|ACSL4_MOUSE Long-chain-fatty-acid--CoA ligase 4 OS=Mus musculus GN=Acsl4 PE=1 SV=2 16 654 5.0E-93
sp|Q9C7W4|LACS3_ARATH Long chain acyl-CoA synthetase 3 OS=Arabidopsis thaliana GN=LACS3 PE=2 SV=1 13 646 1.0E-92
sp|O95573|ACSL3_HUMAN Long-chain-fatty-acid--CoA ligase 3 OS=Homo sapiens GN=ACSL3 PE=1 SV=3 22 654 4.0E-92
sp|Q5R668|ACSL3_PONAB Long-chain-fatty-acid--CoA ligase 3 OS=Pongo abelii GN=ACSL3 PE=2 SV=2 22 654 3.0E-91
sp|Q9CZW4|ACSL3_MOUSE Long-chain-fatty-acid--CoA ligase 3 OS=Mus musculus GN=Acsl3 PE=1 SV=2 14 654 5.0E-91
sp|Q63151|ACSL3_RAT Long-chain-fatty-acid--CoA ligase 3 OS=Rattus norvegicus GN=Acsl3 PE=1 SV=1 16 654 5.0E-90
sp|Q8LKS5|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 10 655 1.0E-88
sp|Q1ZXQ4|FCSB_DICDI Fatty acyl-CoA synthetase B OS=Dictyostelium discoideum GN=fcsB PE=2 SV=1 15 655 1.0E-86
sp|Q9T0A0|LACS4_ARATH Long chain acyl-CoA synthetase 4 OS=Arabidopsis thaliana GN=LACS4 PE=2 SV=1 42 646 2.0E-86
sp|O22898|LACS1_ARATH Long chain acyl-CoA synthetase 1 OS=Arabidopsis thaliana GN=LACS1 PE=2 SV=1 46 654 2.0E-84
sp|Q9T009|LACS5_ARATH Long chain acyl-CoA synthetase 5 OS=Arabidopsis thaliana GN=LACS5 PE=2 SV=1 41 646 3.0E-84
sp|Q9XIA9|LACS2_ARATH Long chain acyl-CoA synthetase 2 OS=Arabidopsis thaliana GN=LACS2 PE=2 SV=1 19 646 4.0E-82
sp|Q8LPS1|LACS6_ARATH Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana GN=LACS6 PE=1 SV=1 101 655 4.0E-82
sp|Q55DR6|FCSA_DICDI Fatty acyl-CoA synthetase A OS=Dictyostelium discoideum GN=fcsA PE=1 SV=1 8 655 1.0E-76
sp|O88813|ACSL5_RAT Long-chain-fatty-acid--CoA ligase 5 OS=Rattus norvegicus GN=Acsl5 PE=1 SV=1 130 655 8.0E-75
sp|P33121|ACSL1_HUMAN Long-chain-fatty-acid--CoA ligase 1 OS=Homo sapiens GN=ACSL1 PE=1 SV=1 104 655 3.0E-74
sp|Q9JID6|ACSL1_CAVPO Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1 104 655 1.0E-73
sp|Q9ULC5|ACSL5_HUMAN Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens GN=ACSL5 PE=1 SV=1 129 655 2.0E-73
sp|P41216|ACSL1_MOUSE Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 104 655 4.0E-73
sp|Q8JZR0|ACSL5_MOUSE Long-chain-fatty-acid--CoA ligase 5 OS=Mus musculus GN=Acsl5 PE=1 SV=1 129 655 1.0E-72
sp|P18163|ACSL1_RAT Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus GN=Acsl1 PE=1 SV=1 104 655 5.0E-71
sp|P33124|ACSL6_RAT Long-chain-fatty-acid--CoA ligase 6 OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 104 655 5.0E-65
sp|Q91WC3|ACSL6_MOUSE Long-chain-fatty-acid--CoA ligase 6 OS=Mus musculus GN=Acsl6 PE=1 SV=1 104 655 7.0E-65
sp|Q9UKU0|ACSL6_HUMAN Long-chain-fatty-acid--CoA ligase 6 OS=Homo sapiens GN=ACSL6 PE=2 SV=4 104 655 7.0E-65
sp|P39518|LCF2_YEAST Long-chain-fatty-acid--CoA ligase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAA2 PE=1 SV=1 10 591 3.0E-46
sp|B2HGV4|FAC15_MYCMM Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD15 PE=3 SV=1 111 578 9.0E-39
sp|P44446|LCFH_HAEIN Putative long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0002 PE=3 SV=1 255 593 5.0E-38
sp|Q7TYX8|FAC15_MYCBO Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD15 PE=3 SV=2 120 578 3.0E-37
sp|O53521|FAC15_MYCTU Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD15 PE=1 SV=3 120 578 2.0E-36
sp|P16405|ORA_PLAFN Octapeptide-repeat antigen (Fragment) OS=Plasmodium falciparum (isolate NF7 / Ghana) PE=2 SV=1 253 591 4.0E-35
sp|Q99PU5|ACBG1_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Mus musculus GN=Acsbg1 PE=1 SV=1 93 627 2.0E-34
sp|Q924N5|ACBG1_RAT Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus GN=Acsbg1 PE=1 SV=1 93 558 2.0E-34
sp|Q96GR2|ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens GN=ACSBG1 PE=2 SV=2 93 639 2.0E-33
sp|Q4R4P9|ACBG1_MACFA Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Macaca fascicularis GN=ACSBG1 PE=2 SV=2 93 628 3.0E-33
sp|Q9LK39|AAE16_ARATH Probable acyl-activating enzyme 16, chloroplastic OS=Arabidopsis thaliana GN=AAE16 PE=2 SV=1 108 595 2.0E-32
sp|Q2KHW5|ACBG1_BOVIN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Bos taurus GN=ACSBG1 PE=2 SV=1 104 639 6.0E-32
sp|Q9V3S9|BGM_DROME Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster GN=bgm PE=2 SV=1 104 618 2.0E-31
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 195 615 3.0E-31
sp|Q8W471|AAE15_ARATH Long-chain-fatty-acid--[acyl-carrier-protein] ligase AEE15, chloroplastic OS=Arabidopsis thaliana GN=AAE15 PE=1 SV=1 108 595 1.0E-30
sp|Q5ZKR7|ACBG2_CHICK Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus GN=ACSBG2 PE=2 SV=2 14 575 5.0E-30
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 254 655 9.0E-30
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 108 598 6.0E-29
sp|P9WQ53|FAD11_MYCTU Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD11 PE=3 SV=1 252 573 8.0E-29
sp|P9WQ52|FAD11_MYCTO Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD11 PE=3 SV=1 252 573 8.0E-29
sp|Q2XU92|ACBG2_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus GN=Acsbg2 PE=1 SV=1 94 568 1.0E-28
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 108 592 1.0E-28
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 108 592 5.0E-28
sp|A1L1K7|ACBG2_RAT Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Rattus norvegicus GN=Acsbg2 PE=2 SV=1 94 568 5.0E-28
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 250 592 5.0E-28
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 251 592 5.0E-27
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 98 591 7.0E-27
sp|Q7ZYC4|ACBG2_XENLA Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopus laevis GN=acsbg2 PE=2 SV=1 72 558 9.0E-27
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 108 592 1.0E-26
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 101 581 2.0E-25
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 101 581 2.0E-25
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 141 582 3.0E-25
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 246 616 3.0E-25
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 101 581 4.0E-25
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 246 616 5.0E-25
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 246 616 5.0E-25
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 93 551 9.0E-25
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 90 566 2.0E-24
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 103 593 3.0E-24
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 254 566 4.0E-24
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 103 566 5.0E-24
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 254 582 1.0E-23
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 254 582 1.0E-23
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 107 566 2.0E-23
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 108 591 4.0E-23
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 248 578 4.0E-23
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 252 566 5.0E-23
sp|Q5FVE4|ACBG2_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Homo sapiens GN=ACSBG2 PE=1 SV=2 210 568 5.0E-23
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 255 604 5.0E-23
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 108 614 5.0E-23
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 119 592 6.0E-23
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 106 582 7.0E-23
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 252 592 2.0E-22
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 252 593 2.0E-22
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 107 592 2.0E-22
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 240 551 3.0E-22
sp|Q9V3U0|BGML_DROME Long-chain-fatty-acid--CoA ligase bubblegum-like OS=Drosophila melanogaster GN=CG4500 PE=2 SV=1 250 578 6.0E-22
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 257 631 8.0E-22
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 253 551 2.0E-21
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 105 627 2.0E-21
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 254 594 2.0E-21
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 170 614 4.0E-21
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 257 596 5.0E-21
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 254 566 5.0E-21
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 253 578 7.0E-21
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 254 592 8.0E-21
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 217 592 1.0E-20
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 259 592 4.0E-20
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 254 592 7.0E-20
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 259 592 8.0E-20
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 254 592 8.0E-20
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 259 592 8.0E-20
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 254 592 8.0E-20
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 105 615 1.0E-19
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 259 592 1.0E-19
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 259 592 2.0E-19
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 259 592 2.0E-19
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 259 573 2.0E-19
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 259 592 2.0E-19
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 253 616 2.0E-19
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 108 597 3.0E-19
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 233 604 6.0E-19
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 254 566 6.0E-19
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 108 592 9.0E-19
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 258 592 1.0E-18
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 190 585 2.0E-18
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 190 585 2.0E-18
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 108 592 2.0E-18
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 257 592 5.0E-18
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 259 564 1.0E-17
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 253 600 1.0E-17
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 107 566 1.0E-17
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 252 566 1.0E-17
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 254 581 2.0E-17
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 246 566 2.0E-17
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 107 566 3.0E-17
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 243 566 3.0E-17
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 246 566 4.0E-17
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 240 601 7.0E-17
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 246 566 7.0E-17
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 256 581 8.0E-17
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 246 566 8.0E-17
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 245 566 8.0E-17
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 246 566 8.0E-17
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 257 601 8.0E-17
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 246 566 8.0E-17
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 246 566 8.0E-17
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 246 566 8.0E-17
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 246 566 8.0E-17
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 246 566 8.0E-17
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 246 566 9.0E-17
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 246 566 9.0E-17
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 246 566 9.0E-17
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 251 585 1.0E-16
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 246 566 1.0E-16
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 246 566 1.0E-16
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 245 566 2.0E-16
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 245 566 2.0E-16
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 245 566 2.0E-16
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 245 566 2.0E-16
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 245 566 2.0E-16
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 245 566 2.0E-16
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 246 566 2.0E-16
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 415 566 3.0E-16
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 245 566 3.0E-16
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 245 566 3.0E-16
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 107 578 4.0E-16
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 170 595 6.0E-16
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 227 586 7.0E-16
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 236 592 1.0E-15
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 254 590 1.0E-15
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 257 601 2.0E-15
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 108 592 2.0E-15
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 246 571 2.0E-15
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 243 566 2.0E-15
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 254 566 3.0E-15
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 438 592 4.0E-15
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 387 615 4.0E-15
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 230 590 5.0E-15
sp|Q00594|ALKK_PSEOL Medium-chain-fatty-acid--CoA ligase OS=Pseudomonas oleovorans GN=alkK PE=3 SV=1 52 592 6.0E-15
sp|Q7N7A9|AAS_PHOLL Bifunctional protein Aas OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aas PE=3 SV=1 252 551 6.0E-15
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 252 592 6.0E-15
sp|Q5HNB2|MENE_STAEQ 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 226 578 1.0E-14
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 119 587 1.0E-14
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 114 614 2.0E-14
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 415 578 3.0E-14
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 108 567 5.0E-14
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 440 614 6.0E-14
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 254 590 6.0E-14
sp|Q7F1X5|4CLL5_ORYSJ 4-coumarate--CoA ligase-like 5 OS=Oryza sativa subsp. japonica GN=4CLL5 PE=2 SV=1 252 592 7.0E-14
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 253 596 9.0E-14
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 108 567 9.0E-14
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 252 574 1.0E-13
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 108 550 1.0E-13
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 254 590 1.0E-13
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 254 590 1.0E-13
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 252 585 1.0E-13
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 202 582 2.0E-13
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 200 545 2.0E-13
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 107 585 2.0E-13
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 252 608 2.0E-13
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 254 590 3.0E-13
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 254 590 3.0E-13
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 254 590 3.0E-13
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 254 590 3.0E-13
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 101 578 3.0E-13
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 250 566 3.0E-13
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 250 550 4.0E-13
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 253 590 4.0E-13
sp|Q8CS21|MENE_STAES 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menE PE=3 SV=1 226 578 5.0E-13
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 254 590 5.0E-13
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 254 590 6.0E-13
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 247 608 6.0E-13
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 254 590 6.0E-13
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 254 590 7.0E-13
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 254 590 8.0E-13
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 254 590 8.0E-13
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 254 578 1.0E-12
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 254 578 1.0E-12
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 254 578 1.0E-12
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 254 578 1.0E-12
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 254 578 1.0E-12
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 252 580 2.0E-12
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 202 565 2.0E-12
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 254 590 2.0E-12
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 252 574 2.0E-12
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 255 590 3.0E-12
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 211 550 4.0E-12
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 253 585 4.0E-12
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 108 567 1.0E-11
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 415 578 1.0E-11
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 245 565 1.0E-11
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 413 566 1.0E-11
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 254 585 2.0E-11
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 414 578 2.0E-11
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 414 578 2.0E-11
sp|Q53634|MENE_STAAU 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus GN=menE PE=3 SV=1 254 578 2.0E-11
sp|A8Z4L9|MENE_STAAT 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menE PE=3 SV=1 254 578 2.0E-11
sp|A6QHX6|MENE_STAAE 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Newman) GN=menE PE=3 SV=1 254 578 2.0E-11
sp|Q5HEY2|MENE_STAAC 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain COL) GN=menE PE=3 SV=1 254 578 2.0E-11
sp|Q2G2V3|MENE_STAA8 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=menE PE=3 SV=1 254 578 2.0E-11
sp|Q2FFU9|MENE_STAA3 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300) GN=menE PE=3 SV=1 254 578 2.0E-11
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 413 566 2.0E-11
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 107 590 3.0E-11
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 107 590 3.0E-11
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 410 595 4.0E-11
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 246 595 4.0E-11
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 415 578 4.0E-11
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 117 605 5.0E-11
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 201 567 6.0E-11
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 107 590 6.0E-11
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 105 592 1.0E-10
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 420 566 2.0E-10
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 107 590 2.0E-10
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 415 592 2.0E-10
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 253 578 2.0E-10
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 253 578 2.0E-10
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 253 578 2.0E-10
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 107 590 3.0E-10
sp|Q9LQ12|4CLL1_ARATH 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 255 582 3.0E-10
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 107 590 3.0E-10
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 107 590 3.0E-10
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 253 573 3.0E-10
sp|P31686|4CL1_SOYBN 4-coumarate--CoA ligase 1 (Fragment) OS=Glycine max PE=2 SV=1 415 627 3.0E-10
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 195 582 4.0E-10
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 202 565 4.0E-10
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 438 566 6.0E-10
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 255 580 6.0E-10
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 231 590 7.0E-10
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 107 590 7.0E-10
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 231 572 9.0E-10
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 438 578 9.0E-10
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 254 580 1.0E-09
sp|Q9CHK3|MENE_LACLA 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 254 585 1.0E-09
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 259 580 1.0E-09
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 255 586 1.0E-09
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 209 580 2.0E-09
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 252 568 2.0E-09
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 441 580 2.0E-09
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 255 565 2.0E-09
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 249 593 2.0E-09
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 255 579 3.0E-09
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 424 582 3.0E-09
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 255 578 4.0E-09
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 252 565 4.0E-09
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 438 578 5.0E-09
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 254 578 5.0E-09
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 239 595 8.0E-09
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 414 566 8.0E-09
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 414 566 8.0E-09
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 414 566 8.0E-09
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 414 566 8.0E-09
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 414 566 8.0E-09
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 414 566 8.0E-09
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 414 566 8.0E-09
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 414 566 8.0E-09
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 414 566 8.0E-09
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 414 566 8.0E-09
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 414 566 8.0E-09
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 414 566 9.0E-09
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 414 566 9.0E-09
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 414 566 9.0E-09
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 414 566 9.0E-09
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 414 566 9.0E-09
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 414 566 9.0E-09
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 414 566 9.0E-09
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 414 566 9.0E-09
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 243 580 1.0E-08
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 415 552 2.0E-08
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 415 552 2.0E-08
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 412 627 2.0E-08
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 414 566 3.0E-08
sp|P37418|MENE_SALTY 2-succinylbenzoate--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=menE PE=3 SV=2 368 591 3.0E-08
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 414 566 3.0E-08
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 414 566 3.0E-08
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 414 566 3.0E-08
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 438 553 3.0E-08
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 415 571 3.0E-08
sp|P37353|MENE_ECOLI 2-succinylbenzoate--CoA ligase OS=Escherichia coli (strain K12) GN=menE PE=1 SV=2 368 591 4.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 413 585 5.0E-08
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 440 582 7.0E-08
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 374 579 8.0E-08
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 465 578 8.0E-08
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 261 592 8.0E-08
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 400 592 1.0E-07
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 255 605 1.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 415 565 1.0E-07
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 440 624 1.0E-07
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 415 573 2.0E-07
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 427 583 2.0E-07
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 246 582 2.0E-07
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 465 576 3.0E-07
sp|Q9SS01|AAE20_ARATH Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 261 592 3.0E-07
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 245 321 5.0E-07
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 466 578 5.0E-07
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 440 592 5.0E-07
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 113 590 5.0E-07
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 245 317 7.0E-07
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 440 582 7.0E-07
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 243 308 9.0E-07
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 438 574 9.0E-07
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 250 564 1.0E-06
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 415 596 1.0E-06
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 254 580 2.0E-06
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 243 308 2.0E-06
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 243 308 2.0E-06
sp|B2HIM0|FAA28_MYCMM Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 257 550 2.0E-06
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 108 591 2.0E-06
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 415 595 3.0E-06
sp|Q8GVF9|4CLL8_ORYSJ Putative 4-coumarate--CoA ligase-like 8 OS=Oryza sativa subsp. japonica GN=4CLL8 PE=3 SV=1 466 592 3.0E-06
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 415 552 4.0E-06
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 243 308 4.0E-06
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 243 308 4.0E-06
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 243 308 4.0E-06
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 243 308 4.0E-06
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 438 556 4.0E-06
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 413 595 5.0E-06
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 243 308 5.0E-06
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 243 308 5.0E-06
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 243 308 5.0E-06
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 410 552 6.0E-06
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 395 552 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1441
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|064950
Agaricus bisporus var bisporus H39 AgabiH39|552300 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|038100
Agaricus bisporus var bisporus H97 AgabiH97|064950
Rhodonia placenta FPRL280 RhoplFPRL280|122_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|552300
MPVDTLRPGFYAKGSVEVEPPSEGQSAVRRLDITKDELVSRPAEGVDTVYDILQYAARTHGSRNALGWRDIIKIH
DVEKEITKAVDGKQVVEKKKWKYYELSDYHYHSFVDVQRIVSEIARGFAELGINSHDVFNVYAQTSPNWQLIAHA
CATLSVTIATAYDCLGEDGLRHSLDEPESIGIFTNDDLLPVLSRVLPDTSSVKFVIYDGEASTKVLESIAAARAD
IKVLHINEVRELGKDKPMEPLEALRPKPENVACIMYTSGTTGAPKGVVITHANLVASVGAVKTLLLHHLSPDDSF
LAYLPLAHVLEYIVELVVLFIGMPAGYGRVKTLTDASVRNCKGDIACFKPTILVGVPAVWETIRKGILAKVNSGG
MIRKAIFNGAVEAKRRNIPILSTMADYLLGSVRAAVGGRLRLSLCGGAAISRETQEFLTTTLVTVLQGYGMTETC
GMCAILPPELMSYGPVGLPVPSVEVKLLDAPDAGYLSTNQTPQGEICIRGPSVTQGYYKRPDLNQDPTIFTQGGW
MRTGDIGQWNPDGTLSIIDRLKNLIKLECGEYIALERLESVYKACTLVANVCVYALPGAKRPIAIVIPHETHLRH
HLGGTTESLEDLCQRSDIRQTVLKECVAVGKKGGLRAMEWLEAVVLTAEDWTPENVYFGLIFVGLLVFGHSWT*
Coding >AgabiH39|552300
ATGCCGGTCGACACTCTCAGGCCCGGATTCTACGCCAAAGGCTCCGTCGAGGTTGAACCACCCAGCGAGGGCCAG
AGCGCCGTTCGTCGTCTAGACATCACAAAGGACGAGCTCGTGTCAAGGCCAGCAGAGGGTGTCGATACCGTATAC
GACATCCTCCAGTACGCTGCTCGTACGCACGGCTCTCGAAATGCACTTGGTTGGAGGGACATAATCAAGATCCAC
GACGTGGAAAAGGAGATTACTAAGGCGGTGGACGGCAAGCAAGTCGTCGAGAAGAAAAAATGGAAATATTACGAG
CTCAGCGACTACCACTATCACTCCTTTGTCGACGTCCAGAGAATCGTCTCCGAAATTGCTCGTGGCTTTGCCGAG
CTCGGTATCAATTCTCATGATGTTTTCAACGTGTATGCTCAGACCAGCCCAAACTGGCAACTCATTGCTCATGCT
TGTGCGACATTGTCGGTGACAATAGCGACTGCTTATGATTGCCTTGGAGAGGATGGCCTCAGGCACTCCTTGGAC
GAGCCCGAATCCATTGGTATATTCACGAATGACGACCTTCTCCCCGTCCTTTCTCGCGTCCTTCCTGACACATCC
TCCGTAAAGTTCGTGATTTACGATGGCGAAGCTTCCACTAAAGTTCTCGAATCAATTGCCGCAGCTCGTGCTGAC
ATCAAGGTCCTCCACATCAATGAAGTTCGTGAACTTGGCAAAGATAAGCCTATGGAACCCCTGGAAGCGCTTCGT
CCCAAGCCCGAAAACGTGGCATGCATCATGTACACTAGTGGTACTACCGGTGCACCCAAAGGCGTTGTTATTACG
CATGCAAACTTAGTTGCGTCCGTTGGAGCTGTCAAAACCCTCCTGTTGCACCACCTCAGCCCCGATGATTCATTT
TTGGCTTATCTGCCCCTCGCTCACGTGTTAGAATACATCGTTGAGCTCGTCGTCCTCTTCATCGGTATGCCTGCT
GGCTACGGGCGCGTCAAGACGCTTACGGATGCCTCGGTTCGCAATTGCAAAGGTGATATCGCTTGCTTTAAGCCT
ACCATCCTAGTAGGTGTCCCTGCTGTTTGGGAAACCATCAGAAAAGGTATCCTAGCGAAAGTGAACAGTGGTGGC
ATGATTCGTAAAGCAATCTTCAACGGGGCTGTCGAGGCCAAGAGGAGGAATATTCCGATTCTCTCCACTATGGCG
GATTACCTTCTGGGTAGCGTTCGTGCTGCCGTTGGTGGGCGTCTGCGTCTCTCCCTTTGTGGTGGTGCCGCCATC
AGTCGCGAAACTCAAGAATTTTTGACGACCACCCTTGTCACTGTACTACAAGGTTATGGAATGACTGAAACATGT
GGCATGTGTGCTATTCTTCCTCCAGAGCTTATGAGCTATGGTCCTGTTGGCCTACCTGTACCCTCCGTTGAAGTC
AAACTCCTTGATGCTCCCGATGCCGGCTACTTGTCTACCAACCAAACACCCCAAGGTGAAATTTGCATTCGGGGT
CCCTCCGTGACCCAAGGATACTACAAGCGTCCCGATCTGAACCAAGACCCAACCATTTTCACCCAGGGTGGTTGG
ATGAGAACTGGCGATATCGGGCAATGGAACCCTGACGGAACATTATCCATCATTGATCGTCTCAAGAACCTCATC
AAGCTCGAATGTGGTGAATATATCGCTCTCGAACGTCTTGAATCGGTATACAAGGCCTGCACCCTCGTCGCCAAC
GTCTGTGTCTATGCCCTTCCCGGTGCCAAACGACCAATAGCCATTGTAATTCCTCACGAAACTCATCTCCGTCAT
CATCTCGGTGGTACCACAGAGTCGCTAGAGGATTTATGCCAACGATCAGATATTCGACAAACAGTATTGAAGGAA
TGCGTTGCTGTTGGGAAGAAGGGTGGGCTCAGAGCTATGGAGTGGCTAGAAGCTGTTGTGTTGACAGCGGAGGAT
TGGACGCCGGAGAACGTCTATTTTGGCCTCATCTTCGTTGGTCTTTTAGTTTTTGGACATTCATGGACTTAG
Transcript >AgabiH39|552300
ATGCCGGTCGACACTCTCAGGCCCGGATTCTACGCCAAAGGCTCCGTCGAGGTTGAACCACCCAGCGAGGGCCAG
AGCGCCGTTCGTCGTCTAGACATCACAAAGGACGAGCTCGTGTCAAGGCCAGCAGAGGGTGTCGATACCGTATAC
GACATCCTCCAGTACGCTGCTCGTACGCACGGCTCTCGAAATGCACTTGGTTGGAGGGACATAATCAAGATCCAC
GACGTGGAAAAGGAGATTACTAAGGCGGTGGACGGCAAGCAAGTCGTCGAGAAGAAAAAATGGAAATATTACGAG
CTCAGCGACTACCACTATCACTCCTTTGTCGACGTCCAGAGAATCGTCTCCGAAATTGCTCGTGGCTTTGCCGAG
CTCGGTATCAATTCTCATGATGTTTTCAACGTGTATGCTCAGACCAGCCCAAACTGGCAACTCATTGCTCATGCT
TGTGCGACATTGTCGGTGACAATAGCGACTGCTTATGATTGCCTTGGAGAGGATGGCCTCAGGCACTCCTTGGAC
GAGCCCGAATCCATTGGTATATTCACGAATGACGACCTTCTCCCCGTCCTTTCTCGCGTCCTTCCTGACACATCC
TCCGTAAAGTTCGTGATTTACGATGGCGAAGCTTCCACTAAAGTTCTCGAATCAATTGCCGCAGCTCGTGCTGAC
ATCAAGGTCCTCCACATCAATGAAGTTCGTGAACTTGGCAAAGATAAGCCTATGGAACCCCTGGAAGCGCTTCGT
CCCAAGCCCGAAAACGTGGCATGCATCATGTACACTAGTGGTACTACCGGTGCACCCAAAGGCGTTGTTATTACG
CATGCAAACTTAGTTGCGTCCGTTGGAGCTGTCAAAACCCTCCTGTTGCACCACCTCAGCCCCGATGATTCATTT
TTGGCTTATCTGCCCCTCGCTCACGTGTTAGAATACATCGTTGAGCTCGTCGTCCTCTTCATCGGTATGCCTGCT
GGCTACGGGCGCGTCAAGACGCTTACGGATGCCTCGGTTCGCAATTGCAAAGGTGATATCGCTTGCTTTAAGCCT
ACCATCCTAGTAGGTGTCCCTGCTGTTTGGGAAACCATCAGAAAAGGTATCCTAGCGAAAGTGAACAGTGGTGGC
ATGATTCGTAAAGCAATCTTCAACGGGGCTGTCGAGGCCAAGAGGAGGAATATTCCGATTCTCTCCACTATGGCG
GATTACCTTCTGGGTAGCGTTCGTGCTGCCGTTGGTGGGCGTCTGCGTCTCTCCCTTTGTGGTGGTGCCGCCATC
AGTCGCGAAACTCAAGAATTTTTGACGACCACCCTTGTCACTGTACTACAAGGTTATGGAATGACTGAAACATGT
GGCATGTGTGCTATTCTTCCTCCAGAGCTTATGAGCTATGGTCCTGTTGGCCTACCTGTACCCTCCGTTGAAGTC
AAACTCCTTGATGCTCCCGATGCCGGCTACTTGTCTACCAACCAAACACCCCAAGGTGAAATTTGCATTCGGGGT
CCCTCCGTGACCCAAGGATACTACAAGCGTCCCGATCTGAACCAAGACCCAACCATTTTCACCCAGGGTGGTTGG
ATGAGAACTGGCGATATCGGGCAATGGAACCCTGACGGAACATTATCCATCATTGATCGTCTCAAGAACCTCATC
AAGCTCGAATGTGGTGAATATATCGCTCTCGAACGTCTTGAATCGGTATACAAGGCCTGCACCCTCGTCGCCAAC
GTCTGTGTCTATGCCCTTCCCGGTGCCAAACGACCAATAGCCATTGTAATTCCTCACGAAACTCATCTCCGTCAT
CATCTCGGTGGTACCACAGAGTCGCTAGAGGATTTATGCCAACGATCAGATATTCGACAAACAGTATTGAAGGAA
TGCGTTGCTGTTGGGAAGAAGGGTGGGCTCAGAGCTATGGAGTGGCTAGAAGCTGTTGTGTTGACAGCGGAGGAT
TGGACGCCGGAGAACGTCTATTTTGGCCTCATCTTCGTTGGTCTTTTAGTTTTTGGACATTCATGGACTTAG
Gene >AgabiH39|552300
ATGCCGGTCGACACTCTCAGGCCCGGATTCTACGCCAAAGGCTCCGTCGAGGTTGAACCACCCAGCGAGGGCCAG
AGCGCCGTTCGTCGTCTAGACATCACAAAGGACGAGCTCGTGTCAAGGCCAGCAGAGGGTGTCGATACCGTATAC
GACATCCTCCAGTACGCTGCTCGTACGCACGGCTCTCGAAATGCACTTGGTTGGAGGGACATAATCAAGATCCAC
GACGTGGAAAAGGAGATTACTAAGGCGGTGGACGGCAAGCAAGTCGTCGAGAAGAAAAAATGGAAATATTACGAG
CTCAGCGACTACCACTATCACTCCTTTGTCGACGTCCAGAGAATCGTCTCCGAAATTGCTCGTGGCTTTGCCGAG
CTCGGTATCAATTCTCATGATGTTTTCAACGTGTATGCTCAGACCAGGTGCGTTATTTACGCCTTGAAAACTCAC
ATTTGTGGTAATATTGAACTGGTTTCAGCCCAAACTGGCAACTCATTGCTCATGCTTGTGCGACATTGTCGGTGA
CAATAGCGACTGCTTATGATTGCCTTGGAGAGGATGGCCTCAGGCACTCCTTGGACGAGCCCGAATCCATTGGTA
TATTCACGAATGACGACCTTCTCCCCGTCCTTTCTCGCGTCCTTCCTGACACATCCTCCGTAAAGTTCGTGATTT
ACGATGGCGAAGCTTCCACTAAAGTTCTCGAATCAATTGCCGCAGCTCGTGCTGACATCAAGGTCCTCCACATCA
ATGAAGTTCGTGAACTTGGCAAAGATAAGCCTATGGAACCCCTGGAAGCGCTTCGTCCCAAGCCCGAAAACGTGG
CATGCATCATGTACACTAGTGGTACTACCGGTGCACCCAAAGGCGTTGTTATTACGCATGCAAACTTAGTTGCGT
CCGTTGGAGCTGTCAAAACCCTCCTGTTGCACCACCTCAGCCCCGATGATTCATTTTTGGCTTATCTGCCCCTCG
CTCACGTGTTAGAATACATCGTTGAGCTCGTCGTCCTCTTCATCGGTATGCCTGCTGGCTACGGGCGCGTCAAGA
CGCTTACGGATGCCTCGGTTCGCAATTGCAAAGGTGATATCGCTTGCTTTAAGCCTACCATCCTAGTAGGTGTCC
CTGCTGTTTGGGAAACCATCAGAAAAGGTATCCTAGCGAAAGTGAACAGTGGTGGCATGATTCGTAAAGCAATCT
TCAACGGGGCTGTCGAGGCCAAGAGGAGGAATATTCCGATTCTCTCCACTATGGCGGATTACCTTCTGGGTAGCG
TTCGTGCTGCCGTTGGTGGGCGTCTGCGTCTCTCCCTTTGTGGTGGTGCCGCCATCAGTCGCGAAACTCAAGAAT
TTTTGACGACCACCCTTGTCACTGTACTACAAGGTACGCTCCAGTATCAATCAGTCCCATTTTCCTCAATTGATA
TGCGTTTGATATACATAGGTTATGGAATGACTGAAACATGTGGCATGTGTGCTATTCTTCCTCCAGAGCTTATGA
GCTATGGTCCTGTTGGCCTACCTGTACCCTCCGTTGAAGTCAAACTCCTTGATGCTCCCGATGCCGGCTACTTGT
CTACCAACCAAACACCCCAAGGTGAAATTTGCATTCGGGGTCCCTCCGTGACCCAAGGATACTACAAGCGTCCCG
ATCTGAACCAAGACCCAACCATTTTCACCCAGGGTGGTTGGATGAGAACTGGCGATATCGGGCAATGGAACCCTG
ACGGAACATTATCCATCATTGATCGGTATGTCAAGACACCATAGCGACATCTGCTCATTACTCATTCCGTAATCT
AGTCTCAAGAACCTCATCAAGCTCGAATGTGGTGAAGTAAGTAGCTGTAATTCAAATTTTATAAAACCATACTGA
GAATACTTCTATGATAGTATATCGCTCTCGAACGTCTTGAATCGGTATACAAGGCCTGCACCCTCGTCGCCAACG
TCTGTGTCTATGCCCTTCCCGGTGCCAAACGACCAATAGCCATTGTAATTCCTCACGAAACTCATCTCCGTCATC
ATCTCGGTGGTACCACAGAGTCGCTAGAGGATTTATGCCAACGATCAGATATTCGACAAACAGTATTGAAGGAAT
GCGTTGCTGTTGGGAAGAAGGGTGGGCTCAGAGCTATGGAGTGGCTAGAAGCTGTTGTGTTGACAGCGGAGGATT
GGACGCCGGAGAACGGTTTGGTCACTGCTGCTCAGAAGATTCAGAGAACGAAGATTGCCAAAGCATTTGATAAGG
AGATCAGAGAGGCTCATACGTAGATCAAGAGAGCTGACGAGCTCGCTGCCTTTTCTTCCTTTCTATCTTCTTTTC
CTCTACCTCTGTCTCTTTTTCGATCGTAGCTCCCGCTTCCATTTAATTCGTAGTCTATTTGTATGTAAATTTTTT
GTGTCTTGTTGTGATCGTATTGTGACTCCTCTACTTCTTTTAGTGGCCTCATCTTCGTTGGTCTTTTAGTTTTTG
GACATTCATGGACTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail