Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|516000
Gene name
Locationscaffold_12b:319077..322979
Strand-
Gene length (bp)3902
Transcript length (bp)3339
Coding sequence length (bp)3339
Protein length (aa) 1113

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18044 zf-CCCH_4 CCCH-type zinc finger 4.1E-07 12 32
PF18044 zf-CCCH_4 CCCH-type zinc finger 8.7E-07 77 97
PF13445 zf-RING_UBOX RING-type zinc-finger 2.4E-05 657 685
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 3.0E-05 657 690

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 597 824 3.0E-19
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 597 830 4.0E-18
sp|Q8ILR9|YPF17_PLAF7 Protein PF14_0175 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0175 PE=3 SV=1 901 1052 4.0E-06

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup716
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|029810
Agaricus bisporus var bisporus H39 AgabiH39|516000 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|029790
Agaricus bisporus var bisporus H97 AgabiH97|029800
Agaricus bisporus var bisporus H97 AgabiH97|029810

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|516000
MVQGTSEKSPQRVCRYYIKGSCRYGNSCWFLHTAPSSCNVGDRATIDSQSEDRSCSNAMSSSSDNSGSKHLSKVD
EPCRRWQGGSCWWGDNCRFRHDAEVEAGRVGETQFADTNEMNVCPATTDDSEGEEHQEAKEMERIERRRKQEEEW
AEDATVTIQKMVLDSFVQFEAGLTIQRVICGFEASQILIKNLPLDAQGPEIIAFFTQQGVDSNDLAILRMDTVDD
HLQATVLGRAKDVEDVAVGLDGIEFRDRKLEFVVCERYLDGCTTGSSHRNFHFLNISFPKPFLSMIVRYPALQLY
KTEESWRELNGKILNGQRIRAELIVDGFDEDSFLPSHVIELSRIPADTTVAEIQTFANTQNVELGRSITSDEVLN
ALESHLRSLPESTFQRFTPDNSSRLQFISVKAFFDTWESANSAHNSLSGRFLRPGFPPLRLSLSAPYRFVLTMDE
NQYNSQKAQWLELCEGKSKEVTILTRTVDRGRRRRVIITLFGRDKQMVGALKVRIKSMAIGQKLDASYWHPIFKD
FKYLEFFDDLYRSTGAYVHNDWKHNCLTVSGPADAAEAAKNRIKEEMKRISTEQWTIPLQRRALGFFVREGLAKM
KGLLGGENVTLDVKSANIVFHGADLEEARHHLKQLLISFSNQNASSSSNTASEENPCPVCYDNISDPFEIGCQHV
YCSSCLRHYILSTFDNHSFPLKCMGSDATCNQPLSLPLIQRFLPRTRFEELMEAAVRSYIDKNPETFKYCNTPDC
SQVYRATTSPQVLQCPSCFAEKDIGEQERLLRRWATESGVKRCPSCQAWVEKSAGWVSEQNRIYDHMSKEHGGFY
NDPEPRVNAGQAVPNDEPDIVDVVGGPAAAAEQMAAFRRLEAGRAYRVQPPANRFWADRPARPPANRMPLAEERV
AEHEALRDQPLQAEARRREAVEQRREEDRQEALRAQRMQRERDLEQTREREEAMRREVEERRREEGRQEALRAQR
IQIEREHEQAREREEVKRREAAEQRREEDRQEALRAQRIQVEHEHEQTREREEAMRREVEERRREEDRQEALRAQ
HLQTEFERELPQNTRTRKEKKGRGAEARRMRNKGSAATIVKGRNDVWLDSVRAHEQFVNVEP*
Coding >AgabiH39|516000
ATGGTTCAAGGAACGTCGGAGAAATCACCGCAACGAGTCTGCAGATATTATATCAAAGGGAGCTGTCGATATGGG
AACAGCTGCTGGTTTCTTCATACTGCGCCATCGTCATGCAATGTAGGTGACAGGGCGACGATTGACAGCCAATCG
GAAGATAGGTCTTGTTCAAATGCAATGAGCTCAAGCTCGGATAATTCAGGAAGTAAGCACCTTAGCAAGGTGGAT
GAGCCTTGTAGGCGGTGGCAAGGAGGTAGTTGTTGGTGGGGAGATAATTGTCGTTTTCGGCATGATGCTGAGGTG
GAGGCTGGTCGTGTAGGCGAGACACAATTTGCAGATACTAATGAGATGAATGTTTGTCCTGCCACTACCGACGAT
TCCGAGGGGGAAGAACATCAAGAGGCGAAAGAAATGGAAAGGATTGAACGACGCCGTAAGCAAGAGGAAGAGTGG
GCTGAAGATGCGACTGTCACGATCCAAAAAATGGTCCTCGACTCATTTGTTCAATTTGAAGCTGGTTTAACCATT
CAACGCGTCATATGCGGTTTCGAAGCATCTCAAATCCTCATAAAAAACCTTCCTTTGGATGCACAGGGACCCGAG
ATCATTGCGTTCTTCACTCAACAAGGTGTTGATTCTAATGACCTTGCCATACTCAGAATGGATACTGTGGATGAT
CATTTACAGGCTACTGTGCTGGGAAGAGCGAAGGATGTAGAGGATGTTGCAGTAGGTTTGGATGGGATAGAGTTT
CGGGATAGAAAACTTGAGTTCGTCGTTTGCGAGAGGTACTTGGATGGTTGTACGACGGGGTCATCACATCGGAAC
TTTCATTTTCTCAACATATCTTTTCCTAAACCGTTCCTCAGTATGATTGTCCGGTATCCCGCCCTCCAATTATAC
AAGACTGAAGAGAGTTGGAGGGAGTTGAATGGAAAGATTCTCAATGGACAAAGGATTCGTGCAGAACTTATAGTT
GATGGTTTTGATGAAGACTCTTTCTTACCTTCTCATGTTATCGAGCTTTCCAGAATACCTGCAGACACCACCGTA
GCCGAGATCCAAACTTTCGCCAACACCCAGAATGTCGAACTGGGTCGTAGCATCACGTCGGATGAAGTACTCAAC
GCACTAGAATCTCATCTTCGCAGTTTACCTGAATCCACCTTTCAAAGATTTACCCCTGACAACTCTTCCCGTCTC
CAATTCATTTCTGTCAAAGCCTTTTTTGACACTTGGGAAAGCGCAAATTCCGCTCACAACAGTCTTTCCGGAAGA
TTCTTGAGGCCTGGATTTCCTCCGCTCCGTCTCTCCCTATCGGCACCCTATCGATTTGTGCTCACTATGGACGAA
AACCAGTATAATTCTCAAAAGGCGCAATGGTTAGAGTTATGTGAGGGAAAGAGCAAGGAGGTGACTATCCTGACG
AGGACCGTTGATCGAGGTAGAAGAAGGAGAGTGATTATCACTTTGTTCGGGCGCGATAAGCAGATGGTAGGTGCC
TTGAAGGTACGTATCAAGAGTATGGCTATTGGCCAGAAACTTGATGCGTCCTATTGGCACCCCATATTCAAGGAT
TTCAAGTATCTCGAATTTTTCGACGATCTCTACCGTAGCACTGGAGCCTACGTTCATAACGATTGGAAGCATAAC
TGCCTCACAGTGTCAGGTCCAGCAGATGCGGCTGAAGCTGCCAAAAATCGTATAAAGGAAGAAATGAAACGTATC
TCGACAGAACAATGGACTATACCGCTTCAACGTCGAGCTTTGGGATTCTTCGTCCGCGAGGGTTTGGCGAAGATG
AAAGGGTTACTTGGAGGGGAGAATGTCACTCTTGATGTCAAGTCCGCGAATATTGTGTTCCATGGTGCCGACCTT
GAAGAGGCCAGACACCACCTCAAACAACTTCTGATCTCGTTCTCGAATCAAAATGCATCATCATCATCCAATACG
GCCTCGGAAGAAAATCCATGCCCAGTTTGTTACGACAACATCTCAGACCCTTTCGAGATCGGGTGTCAACATGTC
TATTGCTCTTCTTGTCTTCGCCATTATATACTCTCTACCTTTGACAACCATAGCTTTCCGTTGAAATGCATGGGA
AGCGATGCTACCTGCAACCAACCCCTTTCACTACCTCTCATCCAGAGATTCCTACCTCGCACGCGATTTGAGGAA
TTGATGGAAGCTGCGGTTCGCTCATACATCGACAAGAATCCAGAGACGTTCAAATATTGTAACACGCCGGATTGC
TCACAAGTATATCGCGCTACCACTTCCCCTCAAGTACTACAGTGTCCATCATGCTTCGCCGAAAAGGATATAGGA
GAACAAGAACGACTACTGAGGCGATGGGCAACTGAAAGTGGTGTCAAGAGATGTCCGTCTTGTCAAGCGTGGGTC
GAGAAGAGCGCCGGGTGGGTTTCCGAACAGAATCGCATCTACGACCATATGAGCAAAGAGCACGGAGGATTTTAT
AATGATCCAGAACCGAGGGTTAACGCGGGACAAGCCGTGCCGAACGATGAACCTGACATTGTAGATGTTGTGGGT
GGGCCGGCGGCGGCGGCCGAACAAATGGCAGCGTTTCGTCGCCTTGAAGCAGGACGTGCATACCGAGTCCAACCA
CCAGCCAATAGGTTTTGGGCCGATCGTCCAGCTAGACCCCCTGCAAACCGGATGCCCTTAGCTGAGGAGCGAGTT
GCGGAGCACGAGGCACTAAGGGATCAGCCACTGCAGGCCGAAGCTAGGAGGAGAGAAGCAGTGGAACAAAGACGC
GAGGAGGACAGACAAGAGGCATTGAGGGCTCAGCGTATGCAGAGAGAACGTGATCTTGAACAGACGAGGGAAAGG
GAAGAAGCTATGAGAAGAGAAGTGGAGGAACGGAGGCGTGAGGAAGGCAGGCAAGAAGCATTAAGGGCTCAGCGT
ATACAAATAGAACGTGAGCATGAACAGGCGAGGGAAAGAGAAGAAGTTAAGAGGAGAGAAGCAGCAGAACAAAGA
CGCGAGGAGGACAGACAAGAAGCATTGAGGGCTCAACGTATACAGGTAGAACATGAGCATGAACAGACGAGGGAA
AGGGAAGAAGCTATGAGGAGAGAGGTGGAGGAACGGAGGCGCGAGGAGGACAGACAAGAAGCATTACGGGCTCAA
CATTTACAGACAGAGTTTGAGCGCGAACTGCCGCAGAACACGAGGACAAGGAAAGAAAAAAAAGGCAGGGGAGCG
GAAGCTCGAAGAATGAGAAACAAGGGATCAGCGGCAACGATCGTAAAGGGCCGAAATGACGTCTGGTTGGACAGT
GTGCGAGCACACGAGCAATTTGTGAATGTGGAACCGTGA
Transcript >AgabiH39|516000
ATGGTTCAAGGAACGTCGGAGAAATCACCGCAACGAGTCTGCAGATATTATATCAAAGGGAGCTGTCGATATGGG
AACAGCTGCTGGTTTCTTCATACTGCGCCATCGTCATGCAATGTAGGTGACAGGGCGACGATTGACAGCCAATCG
GAAGATAGGTCTTGTTCAAATGCAATGAGCTCAAGCTCGGATAATTCAGGAAGTAAGCACCTTAGCAAGGTGGAT
GAGCCTTGTAGGCGGTGGCAAGGAGGTAGTTGTTGGTGGGGAGATAATTGTCGTTTTCGGCATGATGCTGAGGTG
GAGGCTGGTCGTGTAGGCGAGACACAATTTGCAGATACTAATGAGATGAATGTTTGTCCTGCCACTACCGACGAT
TCCGAGGGGGAAGAACATCAAGAGGCGAAAGAAATGGAAAGGATTGAACGACGCCGTAAGCAAGAGGAAGAGTGG
GCTGAAGATGCGACTGTCACGATCCAAAAAATGGTCCTCGACTCATTTGTTCAATTTGAAGCTGGTTTAACCATT
CAACGCGTCATATGCGGTTTCGAAGCATCTCAAATCCTCATAAAAAACCTTCCTTTGGATGCACAGGGACCCGAG
ATCATTGCGTTCTTCACTCAACAAGGTGTTGATTCTAATGACCTTGCCATACTCAGAATGGATACTGTGGATGAT
CATTTACAGGCTACTGTGCTGGGAAGAGCGAAGGATGTAGAGGATGTTGCAGTAGGTTTGGATGGGATAGAGTTT
CGGGATAGAAAACTTGAGTTCGTCGTTTGCGAGAGGTACTTGGATGGTTGTACGACGGGGTCATCACATCGGAAC
TTTCATTTTCTCAACATATCTTTTCCTAAACCGTTCCTCAGTATGATTGTCCGGTATCCCGCCCTCCAATTATAC
AAGACTGAAGAGAGTTGGAGGGAGTTGAATGGAAAGATTCTCAATGGACAAAGGATTCGTGCAGAACTTATAGTT
GATGGTTTTGATGAAGACTCTTTCTTACCTTCTCATGTTATCGAGCTTTCCAGAATACCTGCAGACACCACCGTA
GCCGAGATCCAAACTTTCGCCAACACCCAGAATGTCGAACTGGGTCGTAGCATCACGTCGGATGAAGTACTCAAC
GCACTAGAATCTCATCTTCGCAGTTTACCTGAATCCACCTTTCAAAGATTTACCCCTGACAACTCTTCCCGTCTC
CAATTCATTTCTGTCAAAGCCTTTTTTGACACTTGGGAAAGCGCAAATTCCGCTCACAACAGTCTTTCCGGAAGA
TTCTTGAGGCCTGGATTTCCTCCGCTCCGTCTCTCCCTATCGGCACCCTATCGATTTGTGCTCACTATGGACGAA
AACCAGTATAATTCTCAAAAGGCGCAATGGTTAGAGTTATGTGAGGGAAAGAGCAAGGAGGTGACTATCCTGACG
AGGACCGTTGATCGAGGTAGAAGAAGGAGAGTGATTATCACTTTGTTCGGGCGCGATAAGCAGATGGTAGGTGCC
TTGAAGGTACGTATCAAGAGTATGGCTATTGGCCAGAAACTTGATGCGTCCTATTGGCACCCCATATTCAAGGAT
TTCAAGTATCTCGAATTTTTCGACGATCTCTACCGTAGCACTGGAGCCTACGTTCATAACGATTGGAAGCATAAC
TGCCTCACAGTGTCAGGTCCAGCAGATGCGGCTGAAGCTGCCAAAAATCGTATAAAGGAAGAAATGAAACGTATC
TCGACAGAACAATGGACTATACCGCTTCAACGTCGAGCTTTGGGATTCTTCGTCCGCGAGGGTTTGGCGAAGATG
AAAGGGTTACTTGGAGGGGAGAATGTCACTCTTGATGTCAAGTCCGCGAATATTGTGTTCCATGGTGCCGACCTT
GAAGAGGCCAGACACCACCTCAAACAACTTCTGATCTCGTTCTCGAATCAAAATGCATCATCATCATCCAATACG
GCCTCGGAAGAAAATCCATGCCCAGTTTGTTACGACAACATCTCAGACCCTTTCGAGATCGGGTGTCAACATGTC
TATTGCTCTTCTTGTCTTCGCCATTATATACTCTCTACCTTTGACAACCATAGCTTTCCGTTGAAATGCATGGGA
AGCGATGCTACCTGCAACCAACCCCTTTCACTACCTCTCATCCAGAGATTCCTACCTCGCACGCGATTTGAGGAA
TTGATGGAAGCTGCGGTTCGCTCATACATCGACAAGAATCCAGAGACGTTCAAATATTGTAACACGCCGGATTGC
TCACAAGTATATCGCGCTACCACTTCCCCTCAAGTACTACAGTGTCCATCATGCTTCGCCGAAAAGGATATAGGA
GAACAAGAACGACTACTGAGGCGATGGGCAACTGAAAGTGGTGTCAAGAGATGTCCGTCTTGTCAAGCGTGGGTC
GAGAAGAGCGCCGGGTGGGTTTCCGAACAGAATCGCATCTACGACCATATGAGCAAAGAGCACGGAGGATTTTAT
AATGATCCAGAACCGAGGGTTAACGCGGGACAAGCCGTGCCGAACGATGAACCTGACATTGTAGATGTTGTGGGT
GGGCCGGCGGCGGCGGCCGAACAAATGGCAGCGTTTCGTCGCCTTGAAGCAGGACGTGCATACCGAGTCCAACCA
CCAGCCAATAGGTTTTGGGCCGATCGTCCAGCTAGACCCCCTGCAAACCGGATGCCCTTAGCTGAGGAGCGAGTT
GCGGAGCACGAGGCACTAAGGGATCAGCCACTGCAGGCCGAAGCTAGGAGGAGAGAAGCAGTGGAACAAAGACGC
GAGGAGGACAGACAAGAGGCATTGAGGGCTCAGCGTATGCAGAGAGAACGTGATCTTGAACAGACGAGGGAAAGG
GAAGAAGCTATGAGAAGAGAAGTGGAGGAACGGAGGCGTGAGGAAGGCAGGCAAGAAGCATTAAGGGCTCAGCGT
ATACAAATAGAACGTGAGCATGAACAGGCGAGGGAAAGAGAAGAAGTTAAGAGGAGAGAAGCAGCAGAACAAAGA
CGCGAGGAGGACAGACAAGAAGCATTGAGGGCTCAACGTATACAGGTAGAACATGAGCATGAACAGACGAGGGAA
AGGGAAGAAGCTATGAGGAGAGAGGTGGAGGAACGGAGGCGCGAGGAGGACAGACAAGAAGCATTACGGGCTCAA
CATTTACAGACAGAGTTTGAGCGCGAACTGCCGCAGAACACGAGGACAAGGAAAGAAAAAAAAGGCAGGGGAGCG
GAAGCTCGAAGAATGAGAAACAAGGGATCAGCGGCAACGATCGTAAAGGGCCGAAATGACGTCTGGTTGGACAGT
GTGCGAGCACACGAGCAATTTGTGAATGTGGAACCGTGA
Gene >AgabiH39|516000
ATGGTTCAAGGAACGTCGGAGAAATCACCGCAACGAGTCTGCAGATATTATATCAAAGGGAGCTGTCGATATGGG
AACAGCTGCTGGTTTCTTCATACTGTCCGTTGATCGTTTTATCGCCCGTCCGCCTCTGCTGACCGTATCGATTTC
GGTGAATCACCTTAGGCGCCATCGTCATGCAATGTAGGTGACAGGGCGACGATTGACAGCCAATCGGAAGATAGG
TCTTGTTCAAATGCAATGTATGTTCTCCGTTAAATTGTATCTTTGACTTGAACCTCTCAATGAATCGTCAATGTC
TTTGTTGTTATAGGAGCTCAAGCTCGGATAATTCAGGAAGTAAGCACCTTAGCAAGGTGGATGAGCCTTGTAGGC
GGTGGCAAGGAGGTAGTTGTTGGTGGGGAGATAATTGTCGTTTTCGGCATGATGCTGAGGTGGAGGTAAATTTCC
GTTACTATGTACTATGAGCCCTTTTTCTGATAATCCTTTTTGTTTTTGTCAATTTTACAGGCTGGTCGTGTAGGC
GAGACACAATTTGCAGATACTAATGAGATGAATGTTTGTCCTGCCACTACCGACGATTCCGAGGGGGAAGAACAT
CAAGAGGCGAAAGAAATGGAAAGGATTGAACGACGCCGTAAGCAAGAGGAAGAGTGGGCTGAAGATGCGACTGTC
ACGATCCAAAAAATGGTCCTCGACTCATTTGTTCAATTTGAAGCTGGTTTAACCATTCAACGCGTCATATGCGGT
TTCGAAGCATCTCAAATCCTCATAAAAAACCTTCCTTTGGATGCACAGGGACCCGAGATCATTGCGTTCTTCACT
CAACAAGGTGTTGATTCTAATGACCTTGCCATACTCAGAATGGATACTGTGGATGATCATTTACAGGCTACTGTG
CTGGGAAGAGCGAAGGATGTAGAGGATGTTGCAGTAGGTTTGGATGGGATAGAGTTTCGGGATAGAAAACTTGAG
TTCGTCGTTTGCGAGAGGTACTTGGATGGTTGTACGACGGGGTCATCACATCGGAACTTTCATTTTCTCAACATA
TCTTTTCCTAAACCGTTCCTCAGTATGATTGTCCGGTATCCCGCCCTCCAATTATACAAGACTGAAGAGAGTTGG
AGGGAGTTGAATGGAAAGATTCTCAATGGACAAAGGATTCGTGCAGAACTTATAGTTGATGGTTTTGATGAAGAC
TCTTTCTTACCTTCTCATGTTATCGAGCTTTCCAGAATACCTGCAGACACCACCGTAGCCGAGATCCAAACTTTC
GCCAACACCCAGAATGTCGAACTGGGTCGTAGCATCACGTCGGATGAAGTACTCAACGCACTAGAATCTCATCTT
CGCAGTTTACCTGAATCCACCTTTCAAAGATTTACCCCTGACAACTCTTCCCGTCTCCAATTCATTTCTGTCAAA
GCCTTTTTTGACACTTGGGAAAGCGCAAATTCCGCTCACAACAGTCTTTCCGGAAGATTCTTGAGGCCTGGATTT
CCTCCGCTCCGTCTCTCCCTATCGGCACCCTATCGATTTGTGCTCACTATGGACGAAAACCAGTATAATTCTCAA
AAGGCGCAATGGTTAGAGTTATGTGAGGGAAAGAGCAAGGAGGTGACTATCCTGACGAGGACCGTTGATCGAGGT
AGAAGAAGGAGAGTGATTATCACTTTGTTCGGGCGCGATAAGCAGATGGTAGGTGCCTTGAAGGTACGTATCAAG
AGTATGGCTATTGGCCAGAAACTTGATGCGTCCTATTGGCACCCCATATTCAAGGATTTCAAGTATCTCGAATTT
TTCGACGATCTCTACCGTAGCACTGGAGCCTACGTTCATAACGATTGGAAGCATAACTGCCTCACAGTGTCAGGT
CCAGCAGATGCGGCTGAAGCTGCCAAAAATCGTATAAAGGAAGAAATGAAACGTATCTCGACAGAACAATGGACT
ATACCGCTTCAACGTCGAGCTTTGGGATTCTTCGTCCGCGAGGGTTTGGCGAAGATGAAAGGGTTACTTGGAGGG
GAGAATGTCACTCTTGATGTCAAGTCCGCGAATATTGTGTTCCATGGTGCCGACCTTGAAGAGGCCAGACACCAC
CTCAAACAACTTCTGATCTCGTTCTCGAATCAAAATGCATCATCATCATCCAATACGGCCTCGGAAGAAAATCCA
TGCCCAGTTTGTTACGACAACATCTCAGACCCTTTCGAGATCGGGTGTCAACATGTCTATTGCTCTTCTTGTCTT
CGCCATTATATACTCTCTACCTTTGACAACCATAGCTTTCCGTTGAAATGCATGGGAAGCGATGCTACCTGCAAC
CAACCCCTTTCACTACCTCTCATCCAGAGATTCCTACCTCGCACGCGATTTGAGGAATTGATGGAAGCTGCGGTT
CGCTCATACATCGACAAGAATCCAGAGACGTTCAAATATTGTAACACGCCGGATTGCTCACAAGTATATCGCGCT
ACCACTTCCCCTCAAGTACTACAGTGTCCATCATGCTTCGCCGAAGTGTGTACCGCATGTCATAACGAAGGCCAT
ACTGGAATAACTTGTGCTCAAAGGCTTGCTTAGAAGGATATAGGAGAACAAGAACGACTACTGAGGCGATGGGCA
ACTGAAAGTGGTGTCAAGAGATGTCCGTCTTGTCAAGCGTGGGTCGAGAAGAGCGCCGGGTGTAATCATATGAGT
TGTAAGTGTGGCGCACACTTTTGTTGGATCTGTCTAGGGGTTTCCGAACAGAATCGCATCTACGACCATATGAGC
AAAGAGCACGGAGGATTTTATAATGATCCAGAACCGAGGGTTAACGCGGGACAAGCCGTGCCGAACGATGAACCT
GACATTGTAGATGTTGTGGGTGGGCCGGCGGCGGCGGCCGAACAAATGGCAGCGTTTCGTCGCCTTGAAGCAGGA
CGTGCATACCGAGTCCAACCACCAGCCAATAGGTTTTGGGCCGATCGTCCAGCTAGACCCCCTGCAAACCGGATG
CCCTTAGCTGAGGAGCGAGTTGCGGAGCACGAGGCACTAAGGGATCAGCCACTGCAGGCCGAAGGTGAACAAATT
TGGCGCGAGATAAGAAACTTTGCTGAAAGAGAACAAGCTAGGAGGAGAGAAGCAGTGGAACAAAGACGCGAGGAG
GACAGACAAGAGGCATTGAGGGCTCAGCGTATGCAGAGAGAACGTGATCTTGAACAGACGAGGGAAAGGGAAGAA
GCTATGAGAAGAGAAGTGGAGGAACGGAGGCGTGAGGAAGGCAGGCAAGAAGCATTAAGGGCTCAGCGTATACAA
ATAGAACGTGAGCATGAACAGGCGAGGGAAAGAGAAGAAGTTAAGAGGAGAGAAGCAGCAGAACAAAGACGCGAG
GAGGACAGACAAGAAGCATTGAGGGCTCAACGTATACAGGTAGAACATGAGCATGAACAGACGAGGGAAAGGGAA
GAAGCTATGAGGAGAGAGGTGGAGGAACGGAGGCGTGAGGAAGGCAGACAGGAAGCAATAATGGCTCAGCATATA
CAGATAGAACGAGAGCATGAACAGACGAAGGAAAGAGAAGAAACTACGAGGAGAGAAGTGGAGGAACAGAGGCGC
GAGGAGGACAGACAAGAAGCATTACGGGCTCAACATTTACAGACAGAGTTTGAGCGCGAACTGCCGCAGAACACG
AGGACAAGGAAAGAAAAAAAAGGCAGGGGAGCGGAAGCTCGAAGAATGAGAAACAAGGGATGTACGATTATGTAG
ACGAGTTTTGCAGGGACCATGTCATCTTTCCAACATTACACTTTAACTCAATATACCGTCCACCAGCAGCGGCAA
CGATCGTAAAGGGCCGAAATGACGTCTGGTTGGACAGTGTGCGAGCACACGAGCAATTTGTGAATGTGGAACCGT
GA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail