Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|492900
Gene name
Locationscaffold_11a:372454..373957
Strand+
Gene length (bp)1503
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00646 F-box F-box domain 2.4E-04 2 28

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup1119
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|022780
Agaricus bisporus var bisporus H39 AgabiH39|022890
Agaricus bisporus var bisporus H39 AgabiH39|022920
Agaricus bisporus var bisporus H39 AgabiH39|492900 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|493200
Agaricus bisporus var bisporus H39 AgabiH39|493500
Agaricus bisporus var bisporus H39 AgabiH39|493600
Agaricus bisporus var bisporus H97 AgabiH97|022890
Agaricus bisporus var bisporus H97 AgabiH97|022820
Agaricus bisporus var bisporus H97 AgabiH97|022810
Agaricus bisporus var bisporus H97 AgabiH97|022780
Agaricus bisporus var bisporus H97 AgabiH97|022620
Agaricus bisporus var bisporus H97 AgabiH97|022750
Agaricus bisporus var bisporus H97 AgabiH97|022640
Agaricus bisporus var bisporus H97 AgabiH97|022910
Agaricus bisporus var bisporus H97 AgabiH97|022610
Agaricus bisporus var bisporus H97 AgabiH97|022760
Agaricus bisporus var bisporus H97 AgabiH97|022920

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|492900
MLSDLPPEIVSEIVSHLPYKAILVLRQVFICGDFRDATNAHAVWLNLAKQYLAENPHSHFSTMRLSSLTTDQLRE
RFEKRLMVNDLWQLSKEIYPSVKRLKELSSPVLTTSIAPGGRWLFAGTNKCSLYCWDLDSDNPEPVLLVPCDGIA
NIPGRNNTVAEIDFLVENDDPLSGFIVAFIGMDGNIGKKSSEWLHIWDVIPQDDGTLIAKRLKSLPMPYYGFYPK
LSFNDHLVARTMNEGVDVYWWRECTDTRLVRCTLEFKRNILVSNLYVVGSDKLLVFTRFADKYKARLYALESGYS
EVEELAKAVSHATKIWSFRFSSEYHSRGISRLYFDGANYQQIIVMHGGICNLTIPALQADKTTLTKVADFDLHQE
RAHPQIYGLGFNKGYCRTVFFKPSKAILPLTRSWDGWLQRI*
Coding >AgabiH39|492900
ATGCTAAGCGACCTACCTCCCGAAATTGTTTCGGAAATTGTTTCGCATCTTCCGTATAAAGCCATTCTTGTCCTT
CGCCAGGTCTTCATATGCGGGGACTTCCGCGACGCCACCAACGCCCATGCTGTATGGCTCAACCTCGCAAAGCAA
TATCTAGCAGAAAACCCTCATAGCCATTTTTCAACCATGCGACTATCCTCTCTCACCACCGACCAGCTCCGTGAA
CGGTTCGAAAAACGACTTATGGTAAATGACCTCTGGCAACTATCAAAAGAAATTTATCCTTCTGTAAAGCGTCTA
AAAGAGCTTTCCTCCCCGGTTTTAACTACAAGCATTGCTCCGGGTGGACGATGGTTGTTTGCTGGTACCAACAAA
TGCTCGTTATATTGCTGGGACCTCGATTCCGACAACCCAGAGCCTGTACTCCTGGTGCCCTGTGATGGCATTGCC
AATATTCCCGGGAGGAACAATACAGTCGCTGAAATCGATTTTCTCGTTGAGAACGATGACCCCTTATCCGGGTTC
ATTGTTGCGTTCATTGGGATGGATGGTAACATTGGTAAGAAGTCATCAGAATGGCTTCATATTTGGGACGTCATA
CCACAAGATGATGGTACTCTCATAGCCAAACGTTTAAAGAGTTTACCGATGCCGTACTATGGGTTTTATCCTAAG
TTGTCATTTAATGACCACCTTGTTGCACGTACCATGAACGAGGGGGTGGATGTATACTGGTGGAGGGAGTGCACA
GATACACGCTTAGTTAGGTGTACATTGGAATTTAAAAGAAATATCCTTGTGTCTAATTTATATGTTGTCGGCAGC
GACAAACTTCTTGTCTTCACAAGGTTTGCGGACAAATATAAAGCACGCTTGTACGCCCTGGAGTCAGGATATTCT
GAAGTCGAAGAACTTGCTAAGGCAGTATCGCATGCGACAAAAATCTGGTCATTTCGTTTCAGTTCCGAGTACCAC
AGTCGTGGGATATCACGATTATATTTCGATGGAGCAAACTATCAACAGATCATTGTTATGCATGGTGGTATCTGT
AATCTCACTATACCAGCATTGCAAGCCGACAAAACAACTTTAACAAAGGTTGCAGATTTTGACCTTCATCAAGAA
CGAGCCCACCCTCAAATATACGGCTTGGGCTTTAACAAAGGCTACTGTAGAACCGTGTTCTTCAAACCGTCGAAA
GCCATCCTACCTTTGACGAGGAGCTGGGACGGCTGGTTACAACGTATATGA
Transcript >AgabiH39|492900
ATGCTAAGCGACCTACCTCCCGAAATTGTTTCGGAAATTGTTTCGCATCTTCCGTATAAAGCCATTCTTGTCCTT
CGCCAGGTCTTCATATGCGGGGACTTCCGCGACGCCACCAACGCCCATGCTGTATGGCTCAACCTCGCAAAGCAA
TATCTAGCAGAAAACCCTCATAGCCATTTTTCAACCATGCGACTATCCTCTCTCACCACCGACCAGCTCCGTGAA
CGGTTCGAAAAACGACTTATGGTAAATGACCTCTGGCAACTATCAAAAGAAATTTATCCTTCTGTAAAGCGTCTA
AAAGAGCTTTCCTCCCCGGTTTTAACTACAAGCATTGCTCCGGGTGGACGATGGTTGTTTGCTGGTACCAACAAA
TGCTCGTTATATTGCTGGGACCTCGATTCCGACAACCCAGAGCCTGTACTCCTGGTGCCCTGTGATGGCATTGCC
AATATTCCCGGGAGGAACAATACAGTCGCTGAAATCGATTTTCTCGTTGAGAACGATGACCCCTTATCCGGGTTC
ATTGTTGCGTTCATTGGGATGGATGGTAACATTGGTAAGAAGTCATCAGAATGGCTTCATATTTGGGACGTCATA
CCACAAGATGATGGTACTCTCATAGCCAAACGTTTAAAGAGTTTACCGATGCCGTACTATGGGTTTTATCCTAAG
TTGTCATTTAATGACCACCTTGTTGCACGTACCATGAACGAGGGGGTGGATGTATACTGGTGGAGGGAGTGCACA
GATACACGCTTAGTTAGGTGTACATTGGAATTTAAAAGAAATATCCTTGTGTCTAATTTATATGTTGTCGGCAGC
GACAAACTTCTTGTCTTCACAAGGTTTGCGGACAAATATAAAGCACGCTTGTACGCCCTGGAGTCAGGATATTCT
GAAGTCGAAGAACTTGCTAAGGCAGTATCGCATGCGACAAAAATCTGGTCATTTCGTTTCAGTTCCGAGTACCAC
AGTCGTGGGATATCACGATTATATTTCGATGGAGCAAACTATCAACAGATCATTGTTATGCATGGTGGTATCTGT
AATCTCACTATACCAGCATTGCAAGCCGACAAAACAACTTTAACAAAGGTTGCAGATTTTGACCTTCATCAAGAA
CGAGCCCACCCTCAAATATACGGCTTGGGCTTTAACAAAGGCTACTGTAGAACCGTGTTCTTCAAACCGTCGAAA
GCCATCCTACCTTTGACGAGGAGCTGGGACGGCTGGTTACAACGTATATGA
Gene >AgabiH39|492900
ATGCTAAGCGACCTACCTCCCGAAATTGTTTCGGAAATTGTTTCGCATCTTCCGTATAAAGCCATTCTTGTCCTT
CGCCAGGTGACTTGTTTCATCCTTTCATCCTACTCGATCCGAGGCAGCATTAAAACATCTATCCAGGTCTTCATA
TGCGGGGACTTCCGCGACGCCACCAACGCCCATGCTGTATGGCTCAACCTCGCAAAGCAATATCTAGCAGAAAAC
CCTCATAGCCATTTTTCAACCATGCGACTATCCTCTCTCACCACCGACCAGCTCCGTGAACGGTTCGAAAAACGA
CTTATGGTAAATGACCTCTGGCAACTATCAAAAGAAATTTATCCTTCTGTAAAGCGTCTAAAAGAGCTTTCCTCC
CCGGTTTTAACTACAAGCATTGCTCCGGGTGGACGATGGTTGTTTGCTGGTACCAACAAATGCTCGTTATATTGC
TGGGACCTCGATTCCGACAACCCAGAGCCTGTACTCCTGGTGCCCTGTGATGGCATTGCCAATATTCCCGGGAGG
AACAATACAGTCGCTGAAATCGATTTTCTCGTTGAGAACGATGACCCCTTATCCGGGTTCATTGTTGCGTTCATT
GGGATGGATGGTAAGTCTCTGATTGTATCGTATATGGGAAGAACTGATAGACGGCAATTTCAGGTAACATTGGTA
AGAAGTCATCAGAATGGCTTCATATTTGGGACGTCATACCACAAGATGATGGTACTCTCATAGCCAAACGTTTAA
AGAGTTTACCGATGCCGTACTATGGGTTTTATCCTAAGTTGTCATTTAATGACCACCTTGTTGCACGTACCATGA
ACGAGGGGGTGGATGTATACTGGTGGAGGGAGTGCACAGATACACGCTTAGTTAGGTGTACATTGGAATTTAAAA
GAAATATCCTTGTGGTGTGTAATATGTTCTATCCCAATACGACTTCAACAATAACTATTCCTCAGTCTAATTTAT
ATGTTGTCGGCAGCGACAAACTTCTTGTCTTCACAAGGTTTGCGGACAAATATAAAGCACGCTTGTACGCCCTGG
AGTCAGGATATTCTGAAGTCGAAGAACTTGCTAAGGCAGTATCGCATGCGACAAAAATCTGGTCATTTCGTTTCA
GTTCCGAGTACCACAGTCGTGGGATATCACGATTATATTTCGATGGAGCAAACTATCAACAGATCATTGTTATGC
ATGGTGGTATCTGTAATCTCACTATACCAGCATTGCAAGCCGACAAAACAACTTTAACAAAGGTTGCAGATTTTG
ACCTTCATCAAGAACGAGCCCACCCTCAAATATACGGCTTGGGCTTTAACAAAGGCTACTGTAGAGTGGGTAAGG
AGCTGTGTAGGTTTGGCTACTCGCCGGGTTTAACGAGCGGATCTTACAAATGTGGTGCACCAGTTGACCGGAGAC
TAGACCGTGTTCTTCAAACCGTCGAAAGCCATCCTACCTTTGACGAGGAGCTGGGACGGCTGGTTACAACGTATA
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail