Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|481100
Gene name
Locationscaffold_10:1445879..1449508
Strand-
Gene length (bp)3629
Transcript length (bp)3147
Coding sequence length (bp)3147
Protein length (aa) 1049

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13374 TPR_10 Tetratricopeptide repeat 6.4E-07 766 803
PF13374 TPR_10 Tetratricopeptide repeat 1.2E-09 805 845
PF13374 TPR_10 Tetratricopeptide repeat 3.8E-13 847 888
PF13374 TPR_10 Tetratricopeptide repeat 2.4E-10 890 929
PF13374 TPR_10 Tetratricopeptide repeat 8.1E-11 931 971
PF13374 TPR_10 Tetratricopeptide repeat 1.6E-06 973 1013
PF13374 TPR_10 Tetratricopeptide repeat 6.3E-06 1015 1040
PF13424 TPR_12 Tetratricopeptide repeat 4.9E-11 765 828
PF13424 TPR_12 Tetratricopeptide repeat 1.6E-11 810 870
PF13424 TPR_12 Tetratricopeptide repeat 2.1E-12 851 912
PF01734 Patatin Patatin-like phospholipase 1.1E-18 22 224

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 766 1047 2.0E-26
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 766 1047 4.0E-26
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 766 1039 5.0E-26
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 766 1048 6.0E-25
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 766 1032 9.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 766 1047 2.0E-26
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 766 1047 4.0E-26
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 766 1039 5.0E-26
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 766 1048 6.0E-25
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 766 1032 9.0E-25
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 766 1032 1.0E-24
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 766 1032 1.0E-24
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 9 335 3.0E-24
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 610 1032 5.0E-24
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 766 1047 6.0E-24
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 766 1047 3.0E-23
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 846 1038 7.0E-23
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 846 1038 8.0E-23
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 846 1038 8.0E-23
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 766 1047 9.0E-23
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 9 335 1.0E-22
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 9 335 1.0E-22
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 765 1006 2.0E-22
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 766 1047 2.0E-22
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 766 1047 3.0E-22
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 846 1038 4.0E-22
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 846 1038 5.0E-22
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 846 1038 2.0E-21
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 766 1047 2.0E-21
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 846 1038 3.0E-21
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 846 1038 7.0E-21
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 803 1031 9.0E-21
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 765 960 2.0E-20
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 765 963 2.0E-20
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 846 1038 2.0E-20
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 846 1038 2.0E-20
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 846 1038 2.0E-20
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 803 1003 2.0E-20
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 803 1003 3.0E-20
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 803 996 3.0E-20
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 803 996 3.0E-20
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 846 1038 4.0E-20
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 846 1038 5.0E-20
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 846 1038 6.0E-20
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 765 1025 7.0E-20
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 765 964 7.0E-20
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 846 1038 9.0E-20
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 766 974 1.0E-19
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 846 1038 1.0E-19
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 765 964 2.0E-19
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 766 974 2.0E-19
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 762 964 3.0E-19
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 765 964 4.0E-19
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 765 964 5.0E-19
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 765 964 5.0E-19
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 766 974 7.0E-19
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 765 948 1.0E-18
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 765 1022 1.0E-18
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 766 954 1.0E-18
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 766 954 2.0E-18
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 765 930 2.0E-17
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 883 1040 3.0E-17
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 883 1040 6.0E-17
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 765 964 8.0E-17
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 746 1038 1.0E-16
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 767 1038 1.0E-16
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 19 300 8.0E-16
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 887 1044 1.0E-15
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 882 1040 1.0E-15
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 764 1038 1.0E-15
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 764 1038 1.0E-15
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 883 1043 2.0E-15
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 801 1038 2.0E-15
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 883 1036 3.0E-15
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 883 1036 3.0E-15
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 765 932 3.0E-15
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 765 932 4.0E-15
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 767 1038 4.0E-15
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 765 945 7.0E-15
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 765 912 1.0E-14
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 765 912 1.0E-14
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 887 1036 5.0E-14
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 887 1036 6.0E-14
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 887 1036 8.0E-14
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 883 1036 9.0E-14
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 887 1036 1.0E-13
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 887 1036 1.0E-13
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 743 960 2.0E-13
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 801 1038 2.0E-13
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 743 960 3.0E-12
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 766 960 1.0E-11
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 798 1002 4.0E-11
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 767 1002 4.0E-11
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 742 960 5.0E-11
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 766 960 2.0E-10
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 850 1047 3.0E-10
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 798 1002 4.0E-10
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 798 1002 6.0E-10
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 736 906 1.0E-09
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 723 906 1.0E-09
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 798 1002 1.0E-09
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 736 906 2.0E-09
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 823 1047 2.0E-09
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 801 1047 3.0E-09
sp|Q93ZQ3|PLP9_ARATH Probable inactive patatin-like protein 9 OS=Arabidopsis thaliana GN=PLP9 PE=2 SV=1 20 225 5.0E-09
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 929 1038 2.0E-08
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 929 1038 2.0E-08
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 929 1038 2.0E-08
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 741 1047 4.0E-08
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 850 1047 4.0E-08
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 925 1038 5.0E-08
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 924 1038 7.0E-08
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 929 1038 1.0E-07
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 929 1038 1.0E-07
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 925 1038 1.0E-07
sp|A5HK05|APBP2_RAT Amyloid protein-binding protein 2 OS=Rattus norvegicus GN=Appbp2 PE=2 SV=1 682 1034 1.0E-07
sp|Q9DAX9|APBP2_MOUSE Amyloid protein-binding protein 2 OS=Mus musculus GN=Appbp2 PE=2 SV=1 682 1034 4.0E-07
sp|Q92624|APBP2_HUMAN Amyloid protein-binding protein 2 OS=Homo sapiens GN=APPBP2 PE=1 SV=2 682 1034 4.0E-07
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 21 304 4.0E-07
sp|O80959|PLP6_ARATH Patatin-like protein 6 OS=Arabidopsis thaliana GN=PLP6 PE=2 SV=1 21 247 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup243
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016000
Agaricus bisporus var bisporus H39 AgabiH39|474700
Agaricus bisporus var bisporus H39 AgabiH39|447800
Agaricus bisporus var bisporus H39 AgabiH39|447100
Agaricus bisporus var bisporus H39 AgabiH39|373300
Agaricus bisporus var bisporus H39 AgabiH39|481100 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|281600
Agaricus bisporus var bisporus H39 AgabiH39|278300
Agaricus bisporus var bisporus H39 AgabiH39|053070
Agaricus bisporus var bisporus H39 AgabiH39|371700
Agaricus bisporus var bisporus H97 AgabiH97|109720
Agaricus bisporus var bisporus H97 AgabiH97|016000
Agaricus bisporus var bisporus H97 AgabiH97|016120
Agaricus bisporus var bisporus H97 AgabiH97|020470
Agaricus bisporus var bisporus H97 AgabiH97|052840
Agaricus bisporus var bisporus H97 AgabiH97|052910
Agaricus bisporus var bisporus H97 AgabiH97|053070
Agaricus bisporus var bisporus H97 AgabiH97|054350
Agaricus bisporus var bisporus H97 AgabiH97|089750
Agaricus bisporus var bisporus H97 AgabiH97|109860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|481100
MSSSTRNSGSQSTLDGPPLRLLALDGGGIRGLSELLVLKEVMHQLMLEENKKRKKDGEEPLSELPKPCDYFDLIG
GTGTGGIIALMLGRLRMDVDTAIEKYDDLAKRVFSAMKLWGHGKFKATTLEAAMKSVVQTVTGDSESPLLEGDQP
GACRTFVCAKSAHNMNIPVLFRTYQSRETHVNCKIWEAARATSAAPTFFKRIEIGRNQPSIDGGLGCNNPSQVVL
EEANALFTARAFGCLVSIGTGQAEITKIKKPRVWQRNIPKDVIDALRAITTDCESTHEDMLRRFSILPNTYFRVN
VEQGMQRIKLSKWEKLDNVKAHTIQYMQKVEVTMKLALLVSTIRAPRGQLLLKQLSTPRHPNDLAPQARERKRCP
LPVQPFMGREEILDQMRKYFELGGDSPRVFVLHGLGGSGKTQIAFKFVQESTCFSDVFYIDASNEQTLRTDLEAI
TLGNTERSVDASFHWLANQHEGNWLLFFDHADDVNFKLKDFIPQSGNILITTRNQELRLLSAKNGDAKVGAMEHE
DAKNLLLDRARAEESDENKLLAEAIVKDLHYFALAISQAGAYIHYHLSLSEYRELYRHHHDKLLLDEELQGEDAC
ERAAYATWRLSYDKLNAPARSLLQIFSILHHEGILEEMFEKAASSKMQLEDSGLQNKVTELLDELGSRGPDWSWD
FKQVIERLVSCSFVEYDVRNHTYSIHPLVQQWSRSTVAGNRQLMQKCVLSIICLSISWTFDDQKYKYRRALLQHI
SSSRATVELKQMTPSVLNSMSLVYFEQGQWKEAEALDVAVMKKTKELFGDDHPLTLMSMVNLATTYKNQGQWKEA
EALQVAVMEKTKQLHGDNHRATLTSMANLATTYRNQGKWKEAEALQVAVIEKTKQLLGEDHPDMLTSMGNLATTY
RNQGKWKEAEALEVAVMEKTKELHGDDHPVTLTSMANLATTYRNQGRWKEAEVLEVAVMEKTKQLHGDDHPATLM
SMSNLAAMYWYQELWKEAEALQVVVMEKNKQLYGDYHPATLTSMSNLATTYRSQGQWKEAEALEVVVKDKRKY*
Coding >AgabiH39|481100
ATGTCATCCAGCACAAGGAACTCGGGATCTCAATCAACTTTAGACGGACCACCTTTGAGGCTGCTTGCGCTAGAT
GGCGGTGGGATTCGCGGGCTTTCAGAACTACTCGTCCTCAAAGAAGTTATGCACCAGCTGATGCTTGAGGAGAAC
AAGAAACGGAAGAAGGACGGTGAAGAACCTCTTAGCGAACTCCCGAAGCCGTGCGATTATTTCGATCTGATTGGT
GGTACTGGTACTGGAGGGATAATTGCTTTAATGCTTGGGCGTCTTCGGATGGATGTAGACACCGCAATCGAAAAA
TACGATGATCTGGCAAAACGAGTCTTCTCCGCTATGAAGCTATGGGGACACGGAAAATTCAAAGCGACAACACTC
GAAGCAGCCATGAAATCTGTCGTTCAGACCGTAACTGGTGATTCCGAGTCACCCTTATTAGAAGGTGATCAACCT
GGAGCCTGCCGAACTTTCGTCTGCGCAAAGAGCGCCCACAACATGAACATTCCAGTGCTTTTTAGGACATACCAG
TCTCGTGAAACACATGTCAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCGCCCACATTTTTTAAG
CGCATTGAGATCGGGCGGAACCAGCCCTCTATCGATGGCGGACTAGGCTGCAATAATCCGAGTCAGGTGGTACTG
GAAGAAGCCAATGCTCTATTTACCGCTCGTGCATTCGGGTGCTTGGTGAGCATTGGTACTGGACAGGCCGAAATA
ACCAAGATCAAGAAACCTAGGGTATGGCAGCGAAACATACCAAAAGACGTCATCGATGCGTTAAGGGCAATCACC
ACCGACTGCGAATCAACACACGAAGATATGTTGCGCCGTTTCTCCATTTTGCCGAACACCTATTTTCGCGTAAAT
GTCGAGCAGGGGATGCAGAGAATAAAGCTTTCCAAATGGGAGAAACTGGACAATGTCAAGGCTCATACAATTCAA
TATATGCAGAAGGTAGAGGTCACCATGAAGCTTGCCTTGTTGGTTAGTACGATCAGAGCCCCGCGAGGGCAGCTT
CTACTTAAGCAACTCAGTACTCCTAGGCATCCAAATGATTTGGCGCCACAAGCCAGGGAACGCAAGCGTTGTCCG
CTTCCTGTGCAACCATTTATGGGGCGAGAGGAAATCCTTGATCAGATGCGCAAATATTTTGAGTTGGGGGGTGAT
TCCCCACGTGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTTTCAAATTTGTGCAAGAA
TCAACCTGCTTCTCCGATGTCTTCTACATTGACGCGAGCAATGAACAAACTCTTCGAACAGACCTTGAGGCCATC
ACTCTAGGAAATACAGAGCGATCAGTGGATGCGAGTTTTCATTGGCTTGCAAACCAGCACGAAGGGAACTGGCTT
CTCTTCTTCGACCACGCGGACGATGTGAACTTCAAACTGAAGGATTTCATTCCTCAATCTGGAAACATCTTGATT
ACAACACGTAACCAAGAACTTCGCCTTCTCTCTGCAAAAAACGGGGATGCAAAAGTTGGTGCAATGGAGCACGAG
GACGCAAAAAATCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGTGATGAAAATAAACTGCTGGCAGAGGCGATT
GTAAAGGACCTCCATTACTTTGCGTTGGCTATTTCCCAAGCTGGCGCTTACATTCATTACCACTTGTCATTAAGC
GAATATCGAGAACTTTATCGACATCACCATGACAAACTGCTGCTGGACGAAGAGCTTCAAGGAGAAGATGCATGC
GAACGAGCGGCGTATGCGACGTGGAGACTAAGCTATGACAAACTTAACGCTCCAGCAAGATCTTTGCTCCAAATT
TTCTCGATTCTACACCACGAAGGAATCTTGGAGGAAATGTTCGAAAAGGCGGCATCGTCTAAAATGCAACTGGAG
GATTCCGGACTACAAAACAAAGTGACTGAGTTGTTGGACGAGCTGGGAAGTCGAGGTCCAGACTGGTCTTGGGAC
TTTAAGCAGGTCATCGAGCGCCTTGTTTCATGTTCGTTCGTTGAATATGATGTTCGAAATCACACCTACAGCATC
CATCCACTAGTACAACAGTGGAGTCGTAGCACCGTGGCAGGAAACAGACAGCTCATGCAGAAATGTGTACTCAGC
ATCATTTGCCTATCCATTTCTTGGACGTTCGACGACCAGAAATACAAGTATCGACGCGCACTCTTGCAGCATATC
TCCAGCTCCAGAGCCACAGTCGAATTGAAACAGATGACGCCTTCGGTTTTGAATAGTATGTCACTTGTGTACTTT
GAACAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGATGTTGCGGTGATGAAGAAAACGAAGGAGCTGTTCGGTGAT
GATCATCCTCTTACCCTCATGAGTATGGTCAATCTTGCGACCACGTACAAGAACCAGGGGCAGTGGAAGGAAGCA
GAGGCACTTCAGGTGGCGGTGATGGAGAAAACTAAGCAGCTGCACGGTGATAATCATCGTGCTACCCTCACGAGC
ATGGCCAATCTTGCAACCACGTACAGGAACCAGGGGAAGTGGAAGGAAGCAGAGGCACTTCAGGTGGCTGTGATA
GAGAAGACGAAGCAGCTGCTCGGTGAGGATCATCCTGACATGCTCACGAGTATGGGCAATCTTGCAACCACGTAC
AGGAACCAGGGGAAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGCGGTGATGGAGAAAACGAAGGAGCTGCACGGT
GATGATCATCCTGTTACCCTCACGAGCATGGCCAATCTTGCAACCACGTACAGGAACCAGGGGCGGTGGAAGGAA
GCAGAGGTGCTTGAGGTGGCGGTGATGGAGAAAACTAAGCAGCTGCACGGTGATGATCATCCTGCCACCCTCATG
AGCATGAGTAATCTTGCGGCCATGTACTGGTACCAGGAACTGTGGAAGGAAGCGGAGGCGCTTCAGGTGGTGGTG
ATGGAGAAAAATAAGCAGCTGTATGGTGATTATCATCCTGCCACCCTCACGAGCATGTCCAATCTTGCGACCACG
TACAGGAGCCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTAGTGAAGGACAAGAGGAAATATTGA
Transcript >AgabiH39|481100
ATGTCATCCAGCACAAGGAACTCGGGATCTCAATCAACTTTAGACGGACCACCTTTGAGGCTGCTTGCGCTAGAT
GGCGGTGGGATTCGCGGGCTTTCAGAACTACTCGTCCTCAAAGAAGTTATGCACCAGCTGATGCTTGAGGAGAAC
AAGAAACGGAAGAAGGACGGTGAAGAACCTCTTAGCGAACTCCCGAAGCCGTGCGATTATTTCGATCTGATTGGT
GGTACTGGTACTGGAGGGATAATTGCTTTAATGCTTGGGCGTCTTCGGATGGATGTAGACACCGCAATCGAAAAA
TACGATGATCTGGCAAAACGAGTCTTCTCCGCTATGAAGCTATGGGGACACGGAAAATTCAAAGCGACAACACTC
GAAGCAGCCATGAAATCTGTCGTTCAGACCGTAACTGGTGATTCCGAGTCACCCTTATTAGAAGGTGATCAACCT
GGAGCCTGCCGAACTTTCGTCTGCGCAAAGAGCGCCCACAACATGAACATTCCAGTGCTTTTTAGGACATACCAG
TCTCGTGAAACACATGTCAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCGCCCACATTTTTTAAG
CGCATTGAGATCGGGCGGAACCAGCCCTCTATCGATGGCGGACTAGGCTGCAATAATCCGAGTCAGGTGGTACTG
GAAGAAGCCAATGCTCTATTTACCGCTCGTGCATTCGGGTGCTTGGTGAGCATTGGTACTGGACAGGCCGAAATA
ACCAAGATCAAGAAACCTAGGGTATGGCAGCGAAACATACCAAAAGACGTCATCGATGCGTTAAGGGCAATCACC
ACCGACTGCGAATCAACACACGAAGATATGTTGCGCCGTTTCTCCATTTTGCCGAACACCTATTTTCGCGTAAAT
GTCGAGCAGGGGATGCAGAGAATAAAGCTTTCCAAATGGGAGAAACTGGACAATGTCAAGGCTCATACAATTCAA
TATATGCAGAAGGTAGAGGTCACCATGAAGCTTGCCTTGTTGGTTAGTACGATCAGAGCCCCGCGAGGGCAGCTT
CTACTTAAGCAACTCAGTACTCCTAGGCATCCAAATGATTTGGCGCCACAAGCCAGGGAACGCAAGCGTTGTCCG
CTTCCTGTGCAACCATTTATGGGGCGAGAGGAAATCCTTGATCAGATGCGCAAATATTTTGAGTTGGGGGGTGAT
TCCCCACGTGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTTTCAAATTTGTGCAAGAA
TCAACCTGCTTCTCCGATGTCTTCTACATTGACGCGAGCAATGAACAAACTCTTCGAACAGACCTTGAGGCCATC
ACTCTAGGAAATACAGAGCGATCAGTGGATGCGAGTTTTCATTGGCTTGCAAACCAGCACGAAGGGAACTGGCTT
CTCTTCTTCGACCACGCGGACGATGTGAACTTCAAACTGAAGGATTTCATTCCTCAATCTGGAAACATCTTGATT
ACAACACGTAACCAAGAACTTCGCCTTCTCTCTGCAAAAAACGGGGATGCAAAAGTTGGTGCAATGGAGCACGAG
GACGCAAAAAATCTGCTGCTGGATCGGGCTCGGGCAGAAGAGAGTGATGAAAATAAACTGCTGGCAGAGGCGATT
GTAAAGGACCTCCATTACTTTGCGTTGGCTATTTCCCAAGCTGGCGCTTACATTCATTACCACTTGTCATTAAGC
GAATATCGAGAACTTTATCGACATCACCATGACAAACTGCTGCTGGACGAAGAGCTTCAAGGAGAAGATGCATGC
GAACGAGCGGCGTATGCGACGTGGAGACTAAGCTATGACAAACTTAACGCTCCAGCAAGATCTTTGCTCCAAATT
TTCTCGATTCTACACCACGAAGGAATCTTGGAGGAAATGTTCGAAAAGGCGGCATCGTCTAAAATGCAACTGGAG
GATTCCGGACTACAAAACAAAGTGACTGAGTTGTTGGACGAGCTGGGAAGTCGAGGTCCAGACTGGTCTTGGGAC
TTTAAGCAGGTCATCGAGCGCCTTGTTTCATGTTCGTTCGTTGAATATGATGTTCGAAATCACACCTACAGCATC
CATCCACTAGTACAACAGTGGAGTCGTAGCACCGTGGCAGGAAACAGACAGCTCATGCAGAAATGTGTACTCAGC
ATCATTTGCCTATCCATTTCTTGGACGTTCGACGACCAGAAATACAAGTATCGACGCGCACTCTTGCAGCATATC
TCCAGCTCCAGAGCCACAGTCGAATTGAAACAGATGACGCCTTCGGTTTTGAATAGTATGTCACTTGTGTACTTT
GAACAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGATGTTGCGGTGATGAAGAAAACGAAGGAGCTGTTCGGTGAT
GATCATCCTCTTACCCTCATGAGTATGGTCAATCTTGCGACCACGTACAAGAACCAGGGGCAGTGGAAGGAAGCA
GAGGCACTTCAGGTGGCGGTGATGGAGAAAACTAAGCAGCTGCACGGTGATAATCATCGTGCTACCCTCACGAGC
ATGGCCAATCTTGCAACCACGTACAGGAACCAGGGGAAGTGGAAGGAAGCAGAGGCACTTCAGGTGGCTGTGATA
GAGAAGACGAAGCAGCTGCTCGGTGAGGATCATCCTGACATGCTCACGAGTATGGGCAATCTTGCAACCACGTAC
AGGAACCAGGGGAAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGCGGTGATGGAGAAAACGAAGGAGCTGCACGGT
GATGATCATCCTGTTACCCTCACGAGCATGGCCAATCTTGCAACCACGTACAGGAACCAGGGGCGGTGGAAGGAA
GCAGAGGTGCTTGAGGTGGCGGTGATGGAGAAAACTAAGCAGCTGCACGGTGATGATCATCCTGCCACCCTCATG
AGCATGAGTAATCTTGCGGCCATGTACTGGTACCAGGAACTGTGGAAGGAAGCGGAGGCGCTTCAGGTGGTGGTG
ATGGAGAAAAATAAGCAGCTGTATGGTGATTATCATCCTGCCACCCTCACGAGCATGTCCAATCTTGCGACCACG
TACAGGAGCCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTAGTGAAGGACAAGAGGAAATATTGA
Gene >AgabiH39|481100
ATGTCATCCAGCACAAGGAACTCGGGATCTCAATCAACGTTCTGGGTCCTCTTTCACCAGCTGTCGCAGCAAGCA
GTACTAGGCCTTTCCGTGTGAAAGTTTAGGTGCGTTGCATGCAGCATGTCATATGTCACAGCCTCGAGGCTCAAT
CTTTACTCTTAACGATGACTTCTTCTGCAGACGGACCACCTTTGAGGCTGCTTGCGCTAGGTATATGCGTCCGCT
TGCACCCTCTCACCGATAGAGTCGCTGACTAGTAAACTCTGAACAGATGGCGGTGGGATTCGCGGGCTTTCAGAA
CTACTCGTCCTCAAAGAAGTTATGCACCAGCTGATGCTTGAGGAGAACAAGAAACGGAAGAAGGACGGTGAAGAA
CCTCTTAGCGAACTCCCGAAGCCGTGCGATTATTTCGATCTGATTGGTGGTACTGGTACTGGAGGGTGCGTAGCG
TTATACATCTACAATTGTCTCATGTTACTCACATGTATATTACAGGATAATTGCTTTAATGCTTGGGCGTCTTCG
GATGGATGTAGACACCGCAATCGAAAAATACGATGATCTGGCAAAACGAGTCTTCTCCGCTATGAAGCTATGGGG
ACACGGAAAATTCAAAGCGACAACACTCGAAGCAGCCATGAAATCTGTCGTTCAGACCGTAACTGGTGATTCCGA
GTCACCCTTATTAGAAGGTGATCAACCTGGAGCCTGCCGAACGTGAGTATATTACTTACTCTTCCATGCATTTGG
ACTTTGAATTCGAAGATTTATTAGTTTCGTCTGCGCAAAGAGCGCCCACAACATGAACATTCCAGTGCTTTTTAG
GACATACCAGTCTCGTGAAACACATGTCAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCGCCCAC
ATTTTTTAAGCGCATTGAGATCGGGCGGAACCAGCCCTCTATCGATGGCGGACTAGGCTGCAATAATCCGAGTCA
GGTGGTACTGGAAGAAGCCAATGCTCTATTTACCGCTCGTGCATTCGGGTGCTTGGTGAGCATTGGTACTGGACA
GGCCGAAATAACCAAGATCAAGAAACCTAGGGTATGGCAGCGAAACATACCAAAAGACGTCATCGATGCGTTAAG
GGCAATCACCACCGACTGCGAATCAACACACGAAGATATGTTGCGCCGTTTCTCCATTTTGCCGAACACCTATTT
TCGCGTAAATGTCGAGCAGGGGATGCAGAGAATAAAGCTTTCCAAATGGGAGAAACTGGACAATGTCAAGGCTCA
TACAATTCAATATATGCAGAAGGTAGAGGTCACCATGAAGCTTGCCTTGTTGGTTAGTACGATCAGAGCCCCGCG
AGGGCAGCTTCTACTTAAGCAACTCAGTATGGAAGAATCACTCTTGTAGATCTTCATAATAATCTAATCTCGTTA
CCCTAGGTACTCCTAGGCATCCAAATGATTTGGCGCCACAAGCCAGGGAACGCAAGCGTTGTCCGCTTCCTGTGC
AACCATTTATGGGGCGAGAGGAAATCCTTGATCAGATGCGCAAATATTTTGAGTTGGGGGGTGATTCCCCACGTG
TCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTTTCAAATTTGTGCAAGAATCAACCTGGT
ATGATTCAACTCTCTACAAACTCGCGACTGGCGACAATTTATATGTTTAATTTCCAGCTTCTCCGATGTCTTCTA
CATTGACGCGAGCAATGAACAAACTCTTCGAACAGACCTTGAGGCCATCACTCTAGGAAATACAGAGCGATCAGT
GGATGCGAGTTTTCATTGGCTTGCAAACCAGCACGAAGGGAACTGGCTTCTCTTCTTCGACCACGCGGACGATGT
GAACTTCAAACTGAAGGATTTCATTCCTCAATCTGGAAACATCTTGATTACAACACGTAACCAAGAACTTCGCCT
TCTCTCTGCAAAAAACGGGGATGCAAAAGTTGGTGCAATGGAGCACGAGGACGCAAAAAATCTGCTGCTGGATCG
GGCTCGGGCAGAAGAGAGTGATGAAAATAAACTGCTGGCAGAGGCGATTGTAAAGGTTCTTCCTCTCGTTTTGGT
TTCTTTAAAATACATTTTCAGTCTAAAGCGCGAAACAGGACCTCCATTACTTTGCGTTGGCTATTTCCCAAGCTG
GCGCTTACATTCATTACCACTTGTCATTAAGCGAATATCGAGAACTTTATCGACATCACCATGACAAACTGCTGC
TGGACGAAGAGCTTCAAGGAGAAGATGCATGCGAACGAGCGGCGTATGCGACGTGGAGACTAAGCTATGACAAAC
TTAACGCTCCAGCAAGATCTTTGCTCCAAATTTTCTCGATTCTACACCACGAAGGAATCTTGGAGGAAATGTTCG
AAAAGGCGGCATCGTCTAAAATGCAACTGGAGGATTCCGGACTACAAAACAAAGTGACTGAGTTGTTGGACGAGC
TGGGAAGTCGAGGTCCAGACTGGTCTTGGGACTTTAAGCAGGTCATCGAGCGCCTTGTTTCATGTTCGTTCGTTG
AATATGATGTTCGAAATCACACCTACAGCATCCATCCACTAGTACAACAGTGGAGTCGTAGCACCGTGGCAGGAA
ACAGACAGCTCATGCAGAAATGTGTACTCAGCATCATTTGCCTATCCATTTCTTGGACGTTCGACGACCAGAAAT
ACAAGTATCGACGCGCACTCTTGCAGCATATCTCCAGCTCCAGAGCCACAGTCGAATTGAAACAGATGACGCCTT
CGGTTTTGAATAGTATGTCACTTGTGTACTTTGAACAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGATGTTGCGG
TGATGAAGAAAACGAAGGAGCTGTTCGGTGATGATCATCCTCTTACCCTCATGAGTATGGTCAATCTTGCGACCA
CGTACAAGAACCAGGGGCAGTGGAAGGAAGCAGAGGCACTTCAGGTGGCGGTGATGGAGAAAACTAAGCAGCTGC
ACGGTGATAATCATCGTGCTACCCTCACGAGCATGGCCAATCTTGCAACCACGTACAGGAACCAGGGGAAGTGGA
AGGAAGCAGAGGCACTTCAGGTGGCTGTGATAGAGAAGACGAAGCAGCTGCTCGGTGAGGATCATCCTGACATGC
TCACGAGTATGGGCAATCTTGCAACCACGTACAGGAACCAGGGGAAGTGGAAGGAAGCAGAGGCGCTTGAGGTGG
CGGTGATGGAGAAAACGAAGGAGCTGCACGGTGATGATCATCCTGTTACCCTCACGAGCATGGCCAATCTTGCAA
CCACGTACAGGAACCAGGGGCGGTGGAAGGAAGCAGAGGTGCTTGAGGTGGCGGTGATGGAGAAAACTAAGCAGC
TGCACGGTGATGATCATCCTGCCACCCTCATGAGCATGAGTAATCTTGCGGCCATGTACTGGTACCAGGAACTGT
GGAAGGAAGCGGAGGCGCTTCAGGTGGTGGTGATGGAGAAAAATAAGCAGCTGTATGGTGATTATCATCCTGCCA
CCCTCACGAGCATGTCCAATCTTGCGACCACGTACAGGAGCCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGG
TGGTAGTGAAGGACAAGAGGAAATATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail