Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|474700
Gene name
Locationscaffold_10:347472..351818
Strand+
Gene length (bp)4346
Transcript length (bp)3576
Coding sequence length (bp)3576
Protein length (aa) 1192

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13374 TPR_10 Tetratricopeptide repeat 1.3E-08 766 804
PF13374 TPR_10 Tetratricopeptide repeat 1.5E-11 805 846
PF13374 TPR_10 Tetratricopeptide repeat 1.1E-08 847 887
PF13374 TPR_10 Tetratricopeptide repeat 1.4E-10 889 930
PF13374 TPR_10 Tetratricopeptide repeat 1.8E-08 931 972
PF13374 TPR_10 Tetratricopeptide repeat 1.7E-08 973 1014
PF13374 TPR_10 Tetratricopeptide repeat 3.6E-11 1015 1056
PF13374 TPR_10 Tetratricopeptide repeat 5.6E-10 1057 1097
PF13374 TPR_10 Tetratricopeptide repeat 4.3E-10 1099 1140
PF13374 TPR_10 Tetratricopeptide repeat 7.4E-06 1141 1177
PF13424 TPR_12 Tetratricopeptide repeat 7.2E-14 766 828
PF13176 TPR_7 Tetratricopeptide repeat 2.0E-02 767 789
PF01734 Patatin Patatin-like phospholipase 5.2E-21 17 222
PF07721 TPR_4 Tetratricopeptide repeat 4.9E-01 809 828
PF07721 TPR_4 Tetratricopeptide repeat 4.8E-01 1019 1038
PF07721 TPR_4 Tetratricopeptide repeat 6.1E-01 1061 1080
PF00931 NB-ARC NB-ARC domain 2.4E-07 397 612

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 799 1092 7.0E-33
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 798 1106 6.0E-32
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 803 1089 1.0E-31
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 883 1175 5.0E-31
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 882 1173 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 799 1092 7.0E-33
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 798 1106 6.0E-32
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 803 1089 1.0E-31
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 883 1175 5.0E-31
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 882 1173 1.0E-30
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 687 1092 3.0E-30
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 803 1089 5.0E-30
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 791 1157 1.0E-29
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 803 1105 1.0E-29
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 803 1105 2.0E-29
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 678 1089 2.0E-29
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 791 1128 3.0E-29
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 766 1047 6.0E-29
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 887 1158 6.0E-29
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 887 1173 7.0E-29
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 887 1158 7.0E-29
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 887 1158 1.0E-28
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 803 1105 1.0E-28
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 887 1177 2.0E-28
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 887 1173 2.0E-28
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 815 1178 2.0E-28
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 830 1144 2.0E-28
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 791 1144 2.0E-28
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 815 1178 3.0E-28
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 766 1050 8.0E-28
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 799 1089 1.0E-27
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 883 1177 1.0E-27
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 678 1089 3.0E-27
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 689 1135 3.0E-27
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 887 1173 5.0E-27
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 883 1173 6.0E-27
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 849 1178 8.0E-27
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 766 1090 9.0E-27
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 766 1090 1.0E-26
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 791 1132 1.0E-26
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 799 1089 1.0E-26
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 967 1181 3.0E-26
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 851 1164 3.0E-26
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 883 1173 3.0E-26
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 968 1164 5.0E-26
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 967 1164 7.0E-26
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 967 1164 7.0E-26
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 887 1158 7.0E-26
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 763 1005 8.0E-26
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 766 1047 9.0E-26
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 841 1148 9.0E-26
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 766 1090 1.0E-25
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 766 1064 2.0E-25
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 967 1179 2.0E-25
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 883 1177 2.0E-25
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 766 1064 3.0E-25
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 967 1164 1.0E-24
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 678 1089 1.0E-24
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 763 1008 2.0E-24
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 841 1148 2.0E-24
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 967 1179 2.0E-24
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 729 1164 6.0E-24
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 763 1064 6.0E-24
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 971 1186 7.0E-24
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 746 1073 8.0E-24
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 971 1186 1.0E-23
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 803 1009 2.0E-23
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 803 1009 3.0E-23
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 803 1018 3.0E-23
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 803 1018 3.0E-23
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 754 1064 4.0E-23
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 803 1018 6.0E-23
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 967 1164 7.0E-23
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 763 1005 9.0E-23
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 971 1186 1.0E-22
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 929 1144 6.0E-22
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 929 1122 1.0E-21
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 929 1129 1.0E-21
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 7 339 1.0E-21
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 887 1093 2.0E-21
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 929 1122 2.0E-21
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 929 1129 2.0E-21
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 887 1080 2.0E-21
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 887 1093 3.0E-21
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 971 1164 3.0E-21
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 971 1164 4.0E-21
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 971 1164 5.0E-21
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 887 1087 5.0E-21
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 887 1087 6.0E-21
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 971 1164 9.0E-21
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 971 1164 1.0E-20
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 845 1060 1.0E-20
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 767 1002 2.0E-20
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 845 1051 2.0E-20
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 845 1051 3.0E-20
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 845 1045 5.0E-20
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 845 1045 6.0E-20
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 7 339 6.0E-20
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 767 1002 7.0E-20
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 766 954 8.0E-20
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 766 954 1.0E-19
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 7 339 1.0E-19
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 766 961 2.0E-19
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 766 961 2.0E-19
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 766 954 8.0E-19
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 765 912 2.0E-18
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 14 314 2.0E-18
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 765 912 3.0E-18
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 765 912 3.0E-18
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 765 919 4.0E-18
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 765 919 4.0E-18
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 941 1180 4.0E-12
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 941 1180 5.0E-11
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 1055 1180 1.0E-10
sp|O48723|PLP2_ARATH Patatin-like protein 2 OS=Arabidopsis thaliana GN=PLP2 PE=1 SV=1 14 225 1.0E-10
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 1050 1180 2.0E-10
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 1055 1180 4.0E-10
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 1055 1180 4.0E-10
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 707 1180 4.0E-10
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 1055 1180 4.0E-10
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 1055 1180 9.0E-10
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 786 1180 1.0E-09
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 1055 1180 2.0E-09
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 1055 1180 2.0E-09
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 1055 1180 3.0E-09
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 1055 1180 4.0E-09
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 1055 1180 4.0E-09
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 975 1180 5.0E-09
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 1055 1180 5.0E-09
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 1055 1180 5.0E-09
sp|Q6ZJD3|PLP2_ORYSJ Patatin-like protein 2 OS=Oryza sativa subsp. japonica GN=PLP2 PE=3 SV=1 14 227 1.0E-08
sp|A2YW91|PLP2_ORYSI Patatin-like protein 2 OS=Oryza sativa subsp. indica GN=PLP2 PE=3 SV=1 14 227 1.0E-08
sp|O23179|PLP1_ARATH Patatin-like protein 1 OS=Arabidopsis thaliana GN=PLP1 PE=1 SV=2 6 246 3.0E-08
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 920 1111 1.0E-06
sp|Q93ZQ3|PLP9_ARATH Probable inactive patatin-like protein 9 OS=Arabidopsis thaliana GN=PLP9 PE=2 SV=1 15 223 2.0E-06
sp|F4J5S1|CLU_ARATH Clustered mitochondria protein OS=Arabidopsis thaliana GN=FMT PE=2 SV=1 719 985 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0042802 identical protein binding Yes
GO:0006629 lipid metabolic process Yes
GO:0005515 protein binding Yes
GO:0043531 ADP binding Yes
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0036094 small molecule binding No
GO:0044238 primary metabolic process No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0032555 purine ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup243
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016000
Agaricus bisporus var bisporus H39 AgabiH39|474700 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|447800
Agaricus bisporus var bisporus H39 AgabiH39|447100
Agaricus bisporus var bisporus H39 AgabiH39|373300
Agaricus bisporus var bisporus H39 AgabiH39|481100
Agaricus bisporus var bisporus H39 AgabiH39|281600
Agaricus bisporus var bisporus H39 AgabiH39|278300
Agaricus bisporus var bisporus H39 AgabiH39|053070
Agaricus bisporus var bisporus H39 AgabiH39|371700
Agaricus bisporus var bisporus H97 AgabiH97|109720
Agaricus bisporus var bisporus H97 AgabiH97|016000
Agaricus bisporus var bisporus H97 AgabiH97|016120
Agaricus bisporus var bisporus H97 AgabiH97|020470
Agaricus bisporus var bisporus H97 AgabiH97|052840
Agaricus bisporus var bisporus H97 AgabiH97|052910
Agaricus bisporus var bisporus H97 AgabiH97|053070
Agaricus bisporus var bisporus H97 AgabiH97|054350
Agaricus bisporus var bisporus H97 AgabiH97|089750
Agaricus bisporus var bisporus H97 AgabiH97|109860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|474700
MIAFPCESLEGPPLRLLALDGGGIRGLSELLILKEVMHKLMFEENKKRKKDGEEPLSALPKPCDYFDLIGGTSTG
GIIALMLGRLRMDVDMAIKSYDDLAKQVFSAMKPWGHWGDGKFKATALEAAMKSIVKTVTGDSESPLLEGDQAGV
CRTFVCTKNAYNMHIPVLFRTYQSNETHSNCKIWEAARATSAAPTFFKRIIIGRDQPFIDGGLGRNNPSQVVLAE
ANALFGARQIGCLVSIGTGQAGVNEIKKPGLRQRILPTDVINALRRITTDCESIHEDVLHRFSKLPNTYFRLNVE
QGLQGIELSEWEKLSNVEAHTMQYMRKAEVAQKLALLISTIRVPRGQLPLEQFITPRPPNESVPQARERKRCPLP
VQSFMGREEILDKMRKYFELGGDSRHVFVLHGLGGSGKTQIALKFVQESTCFSNIFYIDATNEQTLRTDLEAITL
GITERSVDASLHWLASLREGNWLLFFDNADDVNLKLKNFIPQCQSGNILVTTRNQELRLLSAKDGDAKIGTMEHE
DAKNLLLYRARAEESDENKVLAEAIVQELHYFALAISQAGAYIHCQLSLSEYREFYRRHHDKLLQHEEFQGEDPY
ERAVYATWSLSYDRLDNSSRSLLQIVSLLNHEGISEKMFEKAASSEEQLEDSELQNKVTELLNELGKRGPDWSWD
FKQVTKRLCSYSLIEYDGRNHTYSIHPLVQQWSRSTMAGNRQLMQKCVLSIIRLSISYTFDDQDYKYRRTLMQHI
SSSRVSIDPEQMMPSVLDNMALVYFEQGQWKEAEALYVVVMEKRKGLLGDDHPDTLTSMANLAATYWKQGQWKEA
EALEVVVMEKSKRLLGDDHPDTLRSMGDLAGMYRDQGQWKEAEALEVVVMEKRKGLLGDDHPYTLTSMANLAATY
KKQGQWKDAEALEVVVMEKSKRLLGDDHPDTLRSMGDLAATYWKQGQWKDAEALEVVVMEKSKRLLGGDHPDTLR
SMGDLAGMYRDQGQWKEAEALEVVVMEKSKGLLGDDHPDTLTSMANLAATYWNQGQWKEAEALEVVVMEKRKGLL
GDDHPDTLTSMANLATTYWKQGQWKEAEALEVVVMEKRKGLLGDDHPYTLASMGNLAATYRDLGQWKEAEALEMV
VMEKRKGLLGDDHPDTLTSMANLAATYRKQGQWKDAEALEVAVREKKKQLLNGDYDYSSLYPTYER*
Coding >AgabiH39|474700
ATGATAGCCTTTCCGTGTGAAAGTTTAGAAGGACCACCTTTGAGGTTGCTTGCGCTAGATGGCGGTGGGATTCGT
GGACTTTCAGAACTACTCATCCTCAAAGAAGTTATGCACAAGCTGATGTTTGAGGAGAACAAGAAACGGAAGAAG
GACGGCGAAGAACCTCTTAGCGCACTTCCGAAGCCGTGCGATTACTTTGATCTGATTGGTGGTACTAGTACTGGA
GGGATAATTGCTTTAATGCTTGGGCGTCTTCGGATGGATGTAGACATGGCAATCAAAAGCTACGATGATCTGGCA
AAACAAGTCTTCTCCGCTATGAAGCCATGGGGGCATTGGGGAGATGGAAAGTTCAAAGCGACAGCACTCGAAGCA
GCCATGAAATCTATCGTGAAGACCGTAACTGGTGATTCCGAGTCACCCTTATTAGAAGGTGATCAAGCTGGAGTC
TGCCGAACTTTCGTCTGCACAAAGAACGCCTACAACATGCACATTCCAGTGCTTTTCAGGACATACCAGTCTAAT
GAAACACATTCAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCACCTACGTTTTTTAAGCGCATT
ATAATTGGGCGGGACCAGCCCTTTATCGATGGTGGACTAGGCCGCAATAATCCGAGTCAGGTGGTACTGGCAGAA
GCCAATGCTCTATTTGGCGCTCGTCAAATCGGGTGCTTGGTGAGCATTGGTACTGGACAGGCCGGAGTAAACGAG
ATCAAGAAACCTGGGTTACGGCAGCGAATCCTACCAACCGACGTCATCAATGCGTTAAGGAGAATTACCACCGAC
TGCGAATCAATACACGAAGATGTGTTGCACCGTTTCTCCAAGTTGCCAAATACCTATTTTCGACTAAATGTCGAG
CAGGGGCTGCAGGGAATAGAGCTTTCCGAATGGGAGAAACTGAGCAATGTGGAGGCTCATACGATGCAGTATATG
AGGAAGGCGGAGGTCGCTCAGAAGCTTGCCTTGTTGATTAGTACGATCAGAGTCCCGAGAGGGCAGCTTCCACTC
GAGCAATTCATTACTCCTAGGCCTCCAAATGAATCGGTCCCACAAGCCAGGGAACGCAAGCGTTGTCCACTTCCT
GTACAATCATTCATGGGACGAGAGGAAATTCTTGATAAGATGCGCAAATATTTCGAGTTGGGGGGTGATTCTCGA
CACGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTTTGAAATTTGTGCAAGAATCAACC
TGCTTCTCCAACATCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACAGACCTTGAGGCCATCACTCTA
GGAATTACAGAGCGATCAGTAGATGCGAGTCTCCATTGGCTTGCAAGCCTGCGCGAAGGGAACTGGCTTCTCTTC
TTCGACAACGCGGACGATGTGAACTTGAAACTGAAGAATTTCATTCCCCAGTGTCAATCTGGAAACATCCTGGTT
ACAACACGTAACCAAGAGCTTCGTCTTCTCTCTGCAAAAGACGGAGATGCAAAAATTGGTACGATGGAGCATGAA
GACGCAAAAAACCTGCTGCTGTATCGGGCTCGGGCAGAAGAGAGCGATGAAAATAAAGTACTGGCAGAGGCAATT
GTACAGGAACTCCATTACTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTACATTCATTGCCAGTTGTCATTAAGC
GAATATCGAGAATTCTATCGACGTCACCATGACAAACTGTTACAGCATGAAGAGTTTCAAGGAGAAGATCCATAC
GAACGAGCAGTGTATGCGACGTGGAGTTTGAGCTACGACAGACTTGATAACTCTTCAAGGTCTTTGCTCCAAATT
GTCTCTTTGCTAAATCACGAAGGGATCTCGGAGAAGATGTTCGAAAAGGCGGCATCGTCTGAAGAGCAACTGGAG
GATTCCGAACTACAAAACAAAGTGACTGAGTTGCTGAACGAGCTGGGAAAACGAGGTCCTGACTGGTCTTGGGAC
TTCAAGCAGGTCACCAAGCGCCTTTGTTCATATTCGCTCATTGAATATGATGGTCGAAATCACACCTACAGCATT
CATCCACTAGTACAACAGTGGAGTCGCAGCACCATGGCAGGAAACAGACAGCTCATGCAGAAATGTGTACTCAGC
ATCATTCGCCTTTCGATTTCTTATACATTCGACGACCAGGACTACAAATATCGACGCACACTCATGCAGCATATC
TCCAGTTCCAGAGTATCGATCGATCCAGAACAAATGATGCCTTCCGTTTTGGATAATATGGCACTTGTGTATTTT
GAACAGGGGCAGTGGAAGGAAGCAGAGGCGCTTTATGTGGTGGTGATGGAGAAGAGGAAGGGGCTGCTTGGTGAT
GATCATCCTGACACACTCACGAGCATGGCCAATCTTGCAGCCACGTACTGGAAGCAGGGGCAGTGGAAGGAAGCA
GAGGCGCTTGAGGTGGTGGTAATGGAGAAGAGTAAGCGGCTGCTTGGTGATGATCATCCTGACACGCTCAGGAGC
ATGGGCGATCTTGCAGGCATGTACAGGGACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATG
GAGAAGAGGAAGGGGCTGCTCGGTGATGATCATCCTTACACACTCACGAGCATGGCCAATCTTGCGGCCACATAC
AAGAAGCAGGGGCAGTGGAAGGACGCAGAGGCGCTTGAGGTGGTGGTAATGGAGAAGAGTAAGCGGCTGCTCGGT
GATGATCATCCTGACACGCTCAGGAGCATGGGCGATCTTGCGGCCACGTACTGGAAGCAGGGGCAGTGGAAGGAC
GCAGAGGCGCTTGAGGTGGTGGTAATGGAGAAGAGTAAGCGGCTGCTTGGTGGTGATCATCCTGACACACTCAGG
AGCATGGGCGATCTTGCAGGCATGTACAGGGACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTAGTGGTG
ATGGAGAAGAGTAAGGGGCTGCTCGGTGATGACCATCCTGACACGCTCACGAGCATGGCCAATCTTGCGGCCACG
TACTGGAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGGGGCTGCTC
GGTGATGACCATCCTGACACACTCACGAGCATGGCCAATCTTGCGACCACATACTGGAAGCAGGGGCAGTGGAAG
GAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGGGGCTGCTCGGTGATGATCATCCTTACACACTC
GCGAGCATGGGCAATCTTGCAGCCACGTACAGGGACCTGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGATGGTG
GTGATGGAGAAGAGGAAGGGGCTGCTCGGTGATGACCATCCTGACACACTCACGAGCATGGCCAATCTTGCGGCC
ACATACAGGAAGCAGGGGCAGTGGAAGGACGCTGAGGCGCTTGAGGTGGCGGTGAGGGAGAAAAAAAAGCAGCTG
CTCAATGGTGATTATGATTATTCGTCTTTGTATCCTACATACGAAAGATGA
Transcript >AgabiH39|474700
ATGATAGCCTTTCCGTGTGAAAGTTTAGAAGGACCACCTTTGAGGTTGCTTGCGCTAGATGGCGGTGGGATTCGT
GGACTTTCAGAACTACTCATCCTCAAAGAAGTTATGCACAAGCTGATGTTTGAGGAGAACAAGAAACGGAAGAAG
GACGGCGAAGAACCTCTTAGCGCACTTCCGAAGCCGTGCGATTACTTTGATCTGATTGGTGGTACTAGTACTGGA
GGGATAATTGCTTTAATGCTTGGGCGTCTTCGGATGGATGTAGACATGGCAATCAAAAGCTACGATGATCTGGCA
AAACAAGTCTTCTCCGCTATGAAGCCATGGGGGCATTGGGGAGATGGAAAGTTCAAAGCGACAGCACTCGAAGCA
GCCATGAAATCTATCGTGAAGACCGTAACTGGTGATTCCGAGTCACCCTTATTAGAAGGTGATCAAGCTGGAGTC
TGCCGAACTTTCGTCTGCACAAAGAACGCCTACAACATGCACATTCCAGTGCTTTTCAGGACATACCAGTCTAAT
GAAACACATTCAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCACCTACGTTTTTTAAGCGCATT
ATAATTGGGCGGGACCAGCCCTTTATCGATGGTGGACTAGGCCGCAATAATCCGAGTCAGGTGGTACTGGCAGAA
GCCAATGCTCTATTTGGCGCTCGTCAAATCGGGTGCTTGGTGAGCATTGGTACTGGACAGGCCGGAGTAAACGAG
ATCAAGAAACCTGGGTTACGGCAGCGAATCCTACCAACCGACGTCATCAATGCGTTAAGGAGAATTACCACCGAC
TGCGAATCAATACACGAAGATGTGTTGCACCGTTTCTCCAAGTTGCCAAATACCTATTTTCGACTAAATGTCGAG
CAGGGGCTGCAGGGAATAGAGCTTTCCGAATGGGAGAAACTGAGCAATGTGGAGGCTCATACGATGCAGTATATG
AGGAAGGCGGAGGTCGCTCAGAAGCTTGCCTTGTTGATTAGTACGATCAGAGTCCCGAGAGGGCAGCTTCCACTC
GAGCAATTCATTACTCCTAGGCCTCCAAATGAATCGGTCCCACAAGCCAGGGAACGCAAGCGTTGTCCACTTCCT
GTACAATCATTCATGGGACGAGAGGAAATTCTTGATAAGATGCGCAAATATTTCGAGTTGGGGGGTGATTCTCGA
CACGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTTTGAAATTTGTGCAAGAATCAACC
TGCTTCTCCAACATCTTCTACATTGACGCGACCAATGAACAAACTCTTCGAACAGACCTTGAGGCCATCACTCTA
GGAATTACAGAGCGATCAGTAGATGCGAGTCTCCATTGGCTTGCAAGCCTGCGCGAAGGGAACTGGCTTCTCTTC
TTCGACAACGCGGACGATGTGAACTTGAAACTGAAGAATTTCATTCCCCAGTGTCAATCTGGAAACATCCTGGTT
ACAACACGTAACCAAGAGCTTCGTCTTCTCTCTGCAAAAGACGGAGATGCAAAAATTGGTACGATGGAGCATGAA
GACGCAAAAAACCTGCTGCTGTATCGGGCTCGGGCAGAAGAGAGCGATGAAAATAAAGTACTGGCAGAGGCAATT
GTACAGGAACTCCATTACTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTACATTCATTGCCAGTTGTCATTAAGC
GAATATCGAGAATTCTATCGACGTCACCATGACAAACTGTTACAGCATGAAGAGTTTCAAGGAGAAGATCCATAC
GAACGAGCAGTGTATGCGACGTGGAGTTTGAGCTACGACAGACTTGATAACTCTTCAAGGTCTTTGCTCCAAATT
GTCTCTTTGCTAAATCACGAAGGGATCTCGGAGAAGATGTTCGAAAAGGCGGCATCGTCTGAAGAGCAACTGGAG
GATTCCGAACTACAAAACAAAGTGACTGAGTTGCTGAACGAGCTGGGAAAACGAGGTCCTGACTGGTCTTGGGAC
TTCAAGCAGGTCACCAAGCGCCTTTGTTCATATTCGCTCATTGAATATGATGGTCGAAATCACACCTACAGCATT
CATCCACTAGTACAACAGTGGAGTCGCAGCACCATGGCAGGAAACAGACAGCTCATGCAGAAATGTGTACTCAGC
ATCATTCGCCTTTCGATTTCTTATACATTCGACGACCAGGACTACAAATATCGACGCACACTCATGCAGCATATC
TCCAGTTCCAGAGTATCGATCGATCCAGAACAAATGATGCCTTCCGTTTTGGATAATATGGCACTTGTGTATTTT
GAACAGGGGCAGTGGAAGGAAGCAGAGGCGCTTTATGTGGTGGTGATGGAGAAGAGGAAGGGGCTGCTTGGTGAT
GATCATCCTGACACACTCACGAGCATGGCCAATCTTGCAGCCACGTACTGGAAGCAGGGGCAGTGGAAGGAAGCA
GAGGCGCTTGAGGTGGTGGTAATGGAGAAGAGTAAGCGGCTGCTTGGTGATGATCATCCTGACACGCTCAGGAGC
ATGGGCGATCTTGCAGGCATGTACAGGGACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATG
GAGAAGAGGAAGGGGCTGCTCGGTGATGATCATCCTTACACACTCACGAGCATGGCCAATCTTGCGGCCACATAC
AAGAAGCAGGGGCAGTGGAAGGACGCAGAGGCGCTTGAGGTGGTGGTAATGGAGAAGAGTAAGCGGCTGCTCGGT
GATGATCATCCTGACACGCTCAGGAGCATGGGCGATCTTGCGGCCACGTACTGGAAGCAGGGGCAGTGGAAGGAC
GCAGAGGCGCTTGAGGTGGTGGTAATGGAGAAGAGTAAGCGGCTGCTTGGTGGTGATCATCCTGACACACTCAGG
AGCATGGGCGATCTTGCAGGCATGTACAGGGACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTAGTGGTG
ATGGAGAAGAGTAAGGGGCTGCTCGGTGATGACCATCCTGACACGCTCACGAGCATGGCCAATCTTGCGGCCACG
TACTGGAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGGGGCTGCTC
GGTGATGACCATCCTGACACACTCACGAGCATGGCCAATCTTGCGACCACATACTGGAAGCAGGGGCAGTGGAAG
GAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGGGGCTGCTCGGTGATGATCATCCTTACACACTC
GCGAGCATGGGCAATCTTGCAGCCACGTACAGGGACCTGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGATGGTG
GTGATGGAGAAGAGGAAGGGGCTGCTCGGTGATGACCATCCTGACACACTCACGAGCATGGCCAATCTTGCGGCC
ACATACAGGAAGCAGGGGCAGTGGAAGGACGCTGAGGCGCTTGAGGTGGCGGTGAGGGAGAAAAAAAAGCAGCTG
CTCAATGGTGATTATGATTATTCGTCTTTGTATCCTACATACGAAAGATGA
Gene >AgabiH39|474700
ATGATAGTTTGTTGAGGAGGAGAGTGTAGGCGAGGCAGGACAATCGAGGGAGGAGCCGGAGCCGGAGGAGGGGCT
GTCTGGGGCGAGAGCAGGGCGCTGGCAGGCGGGGGTCGTCGAGCATGAACAAAGATTAAAAACTGAGGCACACGA
TTTTGGTAGAATCACGGTTTCAAAATCTATAGCGATATCAAACAGGAACAAATAGAAAGTCAGCGGTCCGAAAAC
AAACACAATTCGGCACACCACACTACATCCAGATCTCATTGTTTCGACATAGGACGTCATCCAGCACTAGGAACT
CGGGATCCCGATCAACGTTCGGGGTCCCCTTTCGCTTCTCAATAACCAGTTGTCGCAGCAAACAGTACTAGGCCT
TTCCGTGTGAAAGTTTAGGTGCGTGCATGCAGCATGTCATATCTCACAGCCTCTCCTTGGTCTCAACAATGACTT
CTTCTTCTGCAGAAGGACCACCTTTGAGGTTGCTTGCGCTAGGTATACGCGCCCCTTGCACTCTCTTACCGATAG
AGTCGCTAACTAGTAAGCTCTGAACAGATGGCGGTGGGATTCGTGGACTTTCAGAACTACTCATCCTCAAAGAAG
TTATGCACAAGCTGATGTTTGAGGAGAACAAGAAACGGAAGAAGGACGGCGAAGAACCTCTTAGCGCACTTCCGA
AGCCGTGCGATTACTTTGATCTGATTGGTGGTACTAGTACTGGAGGGTGCGTTGAGTTATGCATCTACAATCGTC
TCATGTTACTCACATGTATATTACAGGATAATTGCTTTAATGCTTGGGCGTCTTCGGATGGATGTAGACATGGCA
ATCAAAAGCTACGATGATCTGGCAAAACAAGTCTTCTCCGCTATGAAGCCATGGGGGCATTGGGGAGATGGAAAG
TTCAAAGCGACAGCACTCGAAGCAGCCATGAAATCTATCGTGAAGACCGTAACTGGTGATTCCGAGTCACCCTTA
TTAGAAGGTGATCAAGCTGGAGTCTGCCGAACGTGAGTATATTACTTAGTCCCATGCTTTTGGACTTTGAATTCG
AAGATTTATTAGTTTCGTCTGCACAAAGAACGCCTACAACATGCACATTCCAGTGCTTTTCAGGACATACCAGTC
TAATGAAACACATTCAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCACCTACGTTTTTTAAGCG
CATTATAATTGGGCGGGACCAGCCCTTTATCGATGGTGGACTAGGCCGCAATAATCCGAGTCAGGTGGTACTGGC
AGAAGCCAATGCTCTATTTGGCGCTCGTCAAATCGGGTGCTTGGTGAGCATTGGTACTGGACAGGCCGGAGTAAA
CGAGATCAAGAAACCTGGGTTACGGCAGCGAATCCTACCAACCGACGTCATCAATGCGTTAAGGAGAATTACCAC
CGACTGCGAATCAATACACGAAGATGTGTTGCACCGTTTCTCCAAGTTGCCAAATACCTATTTTCGACTAAATGT
CGAGCAGGGGCTGCAGGGAATAGAGCTTTCCGAATGGGAGAAACTGAGCAATGTGGAGGCTCATACGATGCAGTA
TATGAGGAAGGCGGAGGTCGCTCAGAAGCTTGCCTTGTTGATTAGTACGATCAGAGTCCCGAGAGGGCAGCTTCC
ACTCGAGCAATTCAGTATGCAAGAATCGCTCTTGTAGATCTTCATAACAAGCTAATCTCGTTACCCTAGTTACTC
CTAGGCCTCCAAATGAATCGGTCCCACAAGCCAGGGAACGCAAGCGTTGTCCACTTCCTGTACAATCATTCATGG
GACGAGAGGAAATTCTTGATAAGATGCGCAAATATTTCGAGTTGGGGGGTGATTCTCGACACGTCTTCGTTTTGC
ATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTTTGAAATTTGTGCAAGAATCAACCTGGTATGGTCCTACTC
TCTACAAATTCGCGACTGGCGACAATTCATGTGTTTAATTTCCAGCTTCTCCAACATCTTCTACATTGACGCGAC
CAATGAACAAACTCTTCGAACAGACCTTGAGGCCATCACTCTAGGAATTACAGAGCGATCAGTAGATGCGAGTCT
CCATTGGCTTGCAAGCCTGCGCGAAGGGAACTGGCTTCTCTTCTTCGACAACGCGGACGATGTGAACTTGAAACT
GAAGAATTTCATTCCCCAGTGTCAATCTGGAAACATCCTGGTTACAACACGTAACCAAGAGCTTCGTCTTCTCTC
TGCAAAAGACGGAGATGCAAAAATTGGTACGATGGAGCATGAAGACGCAAAAAACCTGCTGCTGTATCGGGCTCG
GGCAGAAGAGAGCGATGAAAATAAAGTACTGGCAGAGGCAATTGTACAGGTTCTTCCTCTCATTTTCTTTAGAAG
CGCTCTCAGTCTAAAGCACGAAACAGGAACTCCATTACTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTACATTC
ATTGCCAGTTGTCATTAAGCGAATATCGAGAATTCTATCGACGTCACCATGACAAACTGTTACAGCATGAAGAGT
TTCAAGGAGAAGATCCATACGAACGAGCAGTGTATGCGACGTGGAGTTTGAGCTACGACAGACTTGATAACTCTT
CAAGGTCTTTGCTCCAAATTGTCTCTTTGCTAAATCACGAAGGGATCTCGGAGAAGATGTTCGAAAAGGCGGCAT
CGTCTGAAGAGCAACTGGAGGATTCCGAACTACAAAACAAAGTGACTGAGTTGCTGAACGAGCTGGGAAAACGAG
GTCCTGACTGGTCTTGGGACTTCAAGCAGGTCACCAAGCGCCTTTGTTCATATTCGCTCATTGAATATGATGGTC
GAAATCACACCTACAGCATTCATCCACTAGTACAACAGTGGAGTCGCAGCACCATGGCAGGAAACAGACAGCTCA
TGCAGAAATGTGTACTCAGCATCATTCGCCTTTCGATTTCTTATACATTCGACGACCAGGACTACAAATATCGAC
GCACACTCATGCAGCATATCTCCAGTTCCAGAGTATCGATCGATCCAGAACAAATGATGCCTTCCGTTTTGGATA
ATATGGCACTTGTGTATTTTGAACAGGGGCAGTGGAAGGAAGCAGAGGCGCTTTATGTGGTGGTGATGGAGAAGA
GGAAGGGGCTGCTTGGTGATGATCATCCTGACACACTCACGAGCATGGCCAATCTTGCAGCCACGTACTGGAAGC
AGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTAATGGAGAAGAGTAAGCGGCTGCTTGGTGATGATC
ATCCTGACACGCTCAGGAGCATGGGCGATCTTGCAGGCATGTACAGGGACCAGGGGCAGTGGAAGGAAGCAGAGG
CGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGGGGCTGCTCGGTGATGATCATCCTTACACACTCACGAGCATGG
CCAATCTTGCGGCCACATACAAGAAGCAGGGGCAGTGGAAGGACGCAGAGGCGCTTGAGGTGGTGGTAATGGAGA
AGAGTAAGCGGCTGCTCGGTGATGATCATCCTGACACGCTCAGGAGCATGGGCGATCTTGCGGCCACGTACTGGA
AGCAGGGGCAGTGGAAGGACGCAGAGGCGCTTGAGGTGGTGGTAATGGAGAAGAGTAAGCGGCTGCTTGGTGGTG
ATCATCCTGACACACTCAGGAGCATGGGCGATCTTGCAGGCATGTACAGGGACCAGGGGCAGTGGAAGGAAGCAG
AGGCGCTTGAGGTAGTGGTGATGGAGAAGAGTAAGGGGCTGCTCGGTGATGACCATCCTGACACGCTCACGAGCA
TGGCCAATCTTGCGGCCACGTACTGGAACCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGG
AGAAGAGGAAGGGGCTGCTCGGTGATGACCATCCTGACACACTCACGAGCATGGCCAATCTTGCGACCACATACT
GGAAGCAGGGGCAGTGGAAGGAAGCAGAGGCGCTTGAGGTGGTGGTGATGGAGAAGAGGAAGGGGCTGCTCGGTG
ATGATCATCCTTACACACTCGCGAGCATGGGCAATCTTGCAGCCACGTACAGGGACCTGGGGCAGTGGAAGGAAG
CAGAGGCGCTTGAGATGGTGGTGATGGAGAAGAGGAAGGGGCTGCTCGGTGATGACCATCCTGACACACTCACGA
GCATGGCCAATCTTGCGGCCACATACAGGAAGCAGGGGCAGTGGAAGGACGCTGAGGCGCTTGAGGTGGCGGTGA
GGGAGAAAAAAAAGCAGCTGCTCAATGGTGATTATGATTATTCGTCTTTGTATCCTACATACGAAAGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail