Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|447800
Gene name
Locationscaffold_08:1192716..1196041
Strand+
Gene length (bp)3325
Transcript length (bp)2733
Coding sequence length (bp)2733
Protein length (aa) 911

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13374 TPR_10 Tetratricopeptide repeat 2.8E-06 732 769
PF13374 TPR_10 Tetratricopeptide repeat 1.8E-09 771 812
PF13374 TPR_10 Tetratricopeptide repeat 2.1E-10 813 854
PF13374 TPR_10 Tetratricopeptide repeat 6.7E-06 855 882
PF01734 Patatin Patatin-like phospholipase 9.7E-22 25 227

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 12 344 7.0E-20
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 12 344 3.0E-19
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 22 341 5.0E-19
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 12 334 6.0E-19
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 731 895 4.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9NP80|PLPL8_HUMAN Calcium-independent phospholipase A2-gamma OS=Homo sapiens GN=PNPLA8 PE=1 SV=1 12 344 7.0E-20
sp|Q8K1N1|PLPL8_MOUSE Calcium-independent phospholipase A2-gamma OS=Mus musculus GN=Pnpla8 PE=1 SV=1 12 344 3.0E-19
sp|F4HX15|LPAI_ARATH Phospholipase A I OS=Arabidopsis thaliana GN=PLA1 PE=2 SV=1 22 341 5.0E-19
sp|Q5XTS1|PLPL8_RABIT Calcium-independent phospholipase A2-gamma OS=Oryctolagus cuniculus GN=PNPLA8 PE=1 SV=1 12 334 6.0E-19
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 731 895 4.0E-18
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 731 894 5.0E-18
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 731 894 1.0E-17
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 731 878 1.0E-17
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 731 878 3.0E-17
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 731 886 4.0E-17
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 731 878 4.0E-17
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 731 878 5.0E-17
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 728 894 2.0E-16
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 731 894 2.0E-16
sp|Q5R581|KLC1_PONAB Kinesin light chain 1 OS=Pongo abelii GN=KLC1 PE=2 SV=3 732 908 2.0E-16
sp|Q07866|KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens GN=KLC1 PE=1 SV=2 732 908 2.0E-16
sp|P37285|KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus GN=Klc1 PE=1 SV=2 732 908 3.0E-16
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 616 908 3.0E-16
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 731 885 5.0E-16
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 731 878 9.0E-16
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 713 908 1.0E-15
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 732 908 2.0E-15
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 732 908 2.0E-15
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 731 878 2.0E-15
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 732 908 3.0E-15
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 732 908 4.0E-15
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 710 878 1.0E-14
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 710 885 2.0E-14
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 710 885 2.0E-14
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 732 908 2.0E-14
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 710 878 3.0E-14
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 732 908 3.0E-14
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 710 878 3.0E-14
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 732 908 4.0E-14
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 732 908 5.0E-14
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 732 908 5.0E-14
sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=1 SV=1 732 908 5.0E-14
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 731 909 8.0E-14
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 732 908 9.0E-14
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 732 908 1.0E-13
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 733 907 1.0E-13
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 732 908 2.0E-13
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 732 908 2.0E-13
sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 764 905 7.0E-13
sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 765 905 1.0E-12
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 765 905 1.0E-12
sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 765 905 2.0E-12
sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 702 891 2.0E-12
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 733 907 3.0E-12
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 682 908 3.0E-12
sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 702 887 3.0E-12
sp|Q68G30|KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus GN=Klc3 PE=1 SV=1 769 905 3.0E-12
sp|Q91W40|KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus GN=Klc3 PE=1 SV=1 769 905 4.0E-12
sp|Q2TBQ9|KLC3_BOVIN Kinesin light chain 3 OS=Bos taurus GN=KLC3 PE=2 SV=1 769 905 5.0E-12
sp|Q6P597|KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens GN=KLC3 PE=1 SV=2 769 905 6.0E-12
sp|Q5R8E2|KLC3_PONAB Kinesin light chain 3 OS=Pongo abelii GN=KLC3 PE=2 SV=1 769 905 6.0E-12
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 682 908 7.0E-12
sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 702 884 2.0E-11
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 682 908 2.0E-11
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 733 907 2.0E-11
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 682 908 3.0E-11
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 682 908 4.0E-11
sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 702 891 6.0E-11
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 733 907 7.0E-11
sp|P46825|KLC_DORPE Kinesin light chain OS=Doryteuthis pealeii PE=2 SV=1 731 887 1.0E-10
sp|O23180|PLP5_ARATH Patatin-like protein 5 OS=Arabidopsis thaliana GN=PLP5 PE=1 SV=2 19 303 2.0E-10
sp|O48723|PLP2_ARATH Patatin-like protein 2 OS=Arabidopsis thaliana GN=PLP2 PE=1 SV=1 22 302 3.0E-10
sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 765 905 4.0E-10
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 733 878 7.0E-10
sp|O23179|PLP1_ARATH Patatin-like protein 1 OS=Arabidopsis thaliana GN=PLP1 PE=1 SV=2 19 323 2.0E-09
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 733 878 3.0E-09
sp|O88447|KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus GN=Klc1 PE=1 SV=3 731 903 1.0E-08
sp|B8AQW7|PLP1_ORYSI Patatin-like protein 1 OS=Oryza sativa subsp. indica GN=PLP1 PE=3 SV=1 24 230 1.0E-08
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 733 878 2.0E-08
sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 733 878 3.0E-08
sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 722 909 6.0E-08
sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 733 878 7.0E-08
sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 722 909 1.0E-07
sp|Q6ZJD3|PLP2_ORYSJ Patatin-like protein 2 OS=Oryza sativa subsp. japonica GN=PLP2 PE=3 SV=1 22 232 1.0E-07
sp|A2YW91|PLP2_ORYSI Patatin-like protein 2 OS=Oryza sativa subsp. indica GN=PLP2 PE=3 SV=1 22 232 1.0E-07
sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 722 909 2.0E-07
sp|P97570|PLPL9_RAT 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 24 251 2.0E-07
sp|P97819|PLPL9_MOUSE 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 24 251 2.0E-07
sp|Q93ZQ3|PLP9_ARATH Probable inactive patatin-like protein 9 OS=Arabidopsis thaliana GN=PLP9 PE=2 SV=1 23 228 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup243
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|016000
Agaricus bisporus var bisporus H39 AgabiH39|474700
Agaricus bisporus var bisporus H39 AgabiH39|447800 (this protein)
Agaricus bisporus var bisporus H39 AgabiH39|447100
Agaricus bisporus var bisporus H39 AgabiH39|373300
Agaricus bisporus var bisporus H39 AgabiH39|481100
Agaricus bisporus var bisporus H39 AgabiH39|281600
Agaricus bisporus var bisporus H39 AgabiH39|278300
Agaricus bisporus var bisporus H39 AgabiH39|053070
Agaricus bisporus var bisporus H39 AgabiH39|371700
Agaricus bisporus var bisporus H97 AgabiH97|109720
Agaricus bisporus var bisporus H97 AgabiH97|016000
Agaricus bisporus var bisporus H97 AgabiH97|016120
Agaricus bisporus var bisporus H97 AgabiH97|020470
Agaricus bisporus var bisporus H97 AgabiH97|052840
Agaricus bisporus var bisporus H97 AgabiH97|052910
Agaricus bisporus var bisporus H97 AgabiH97|053070
Agaricus bisporus var bisporus H97 AgabiH97|054350
Agaricus bisporus var bisporus H97 AgabiH97|089750
Agaricus bisporus var bisporus H97 AgabiH97|109860

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|447800
MHRMSSNTTNWGFRSTFEGPPLRLLALDGGGIRGLSELLIIKEVMHKLMFEENEKREKDGKEPLSAPPKPCDYFD
LIGGTSTGGIIALMLGRLQMDVDTAITNYDDLAKQVFSAMKPWGDGKFKATTLEAAMKSVVKNVTGDSESSLLEG
DQARVCRTFVCAKNAHNMEIPVLFRTYQSRETHINCKIWEAARATSAAPTFFKRITIGRDQPFIDGGLGRNNPSQ
VVLEEANALFGTRQIGCLVSIGTGQAGINEIKKPGFWQRILPTDVIDALRRITTDCESTHEAMLHRFSKLPSTYF
RLNVEQGMQGVALSEWEKLSNVEAHTTQYMKKEEVTEKLALLVSAIRAPRGQLPLEQFVTPRPPNESVPQARERK
RCPRPVQPFMGREEILDKMRKYFELGGDSRRVFVLHGLGGSGKTQIAFKFVQESTCFSDVFYIDATNEQTLRTDL
EAITLGNAERSVDASLRWLASQRKGSWLLFFDNADDVNLKLKKFIPQSGNILVTTRNPELRLLSAKDGDAKVGAM
EHEDAINLLLDRAQAEESYENKVLAEAIVQELHYFALAISQAGAYIHCHLSLSEYREFYRRHHDKLLQTEEFQGG
DPYERAVYTTWSLSYEKLDASARSLLQIFSLLNHEGISEKMFEKAALSKKQLEDSELQNKVTELLNELGKRGPDW
SWDFKQHSSTSTTVESIIGLSISWTYDNQDYKYRRTLLQHISSSRASVDPEQMAPSVLSGLALVYSEQGQWKEAE
VLEVVVIEKRKLLLGDDHPVTLTSMANLAGTYRNQGKWNKAEALEMVVMKKTKRLLVDDHPDTLTSMANLAGTYR
DQEKWNEAEALQVVMMEKTKRLLGDDHPDTLTSMANLATTYRDQGKWKEAEALEVVVMKKTKWLRDDDHPHTLTS
MTNLASMYRD*
Coding >AgabiH39|447800
ATGCATAGGATGTCATCTAATACAACGAACTGGGGATTCCGATCAACTTTCGAAGGACCACCTTTGAGGCTGCTT
GCGCTAGATGGCGGTGGGATTCGCGGACTTTCAGAACTACTCATCATCAAAGAAGTCATGCACAAGCTGATGTTT
GAGGAGAACGAGAAACGGGAAAAGGACGGCAAAGAACCTCTTAGCGCACCCCCGAAGCCGTGCGATTACTTCGAT
CTGATTGGTGGTACTAGTACTGGAGGGATAATTGCTTTGATGCTCGGGCGTCTCCAGATGGATGTAGACACGGCA
ATCACAAACTATGATGATCTCGCGAAACAAGTCTTCTCCGCTATGAAGCCATGGGGAGATGGAAAATTCAAAGCG
ACAACACTCGAAGCAGCCATGAAATCTGTCGTGAAGAACGTAACTGGTGATTCAGAGTCATCCTTATTAGAAGGC
GATCAAGCTAGAGTCTGCCGAACTTTCGTCTGTGCCAAGAACGCCCACAACATGGAAATTCCAGTGCTTTTCAGG
ACATACCAGTCTCGTGAAACACATATAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCACCCACA
TTTTTCAAGCGCATTACAATTGGGCGGGACCAGCCCTTTATCGATGGCGGACTAGGCCGCAATAATCCGAGTCAG
GTGGTCCTGGAAGAAGCCAATGCTCTATTTGGCACTCGTCAAATCGGGTGCTTGGTGAGCATTGGTACTGGACAG
GCCGGAATAAACGAGATCAAGAAACCTGGTTTTTGGCAGCGAATCTTACCAACCGATGTCATCGATGCGTTAAGG
AGAATTACCACCGACTGCGAATCAACACACGAAGCTATGTTGCACCGTTTTTCCAAGTTGCCGAGCACCTATTTT
CGGCTAAATGTCGAGCAGGGGATGCAGGGAGTAGCGCTCTCCGAATGGGAGAAACTGAGCAATGTGGAGGCTCAT
ACAACGCAATATATGAAGAAGGAGGAGGTCACCGAGAAACTTGCCTTGTTGGTTAGTGCGATCAGAGCCCCGAGA
GGGCAGCTTCCACTCGAGCAATTCGTTACTCCTAGGCCTCCCAATGAATCGGTTCCACAAGCCAGGGAACGCAAA
CGTTGTCCGCGTCCTGTGCAACCATTTATGGGACGAGAAGAAATCCTTGATAAGATGCGCAAATATTTTGAGTTG
GGGGGTGATTCTCGACGCGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTTTCAAATTT
GTGCAAGAATCAACCTGCTTCTCCGATGTCTTCTACATTGACGCTACCAATGAACAAACTCTTCGAACAGACCTT
GAGGCCATCACTCTAGGGAATGCAGAGCGATCAGTAGATGCAAGTCTCCGTTGGCTTGCAAGCCAGCGCAAGGGA
AGCTGGCTTCTCTTCTTCGACAACGCGGACGATGTGAACTTGAAACTGAAGAAATTCATTCCTCAATCTGGAAAC
ATCCTGGTTACAACACGTAATCCAGAGCTTCGCCTTCTCTCCGCGAAAGACGGGGATGCAAAAGTTGGTGCGATG
GAGCACGAAGACGCAATAAACCTGCTGCTGGATCGGGCTCAGGCAGAAGAGAGCTATGAAAATAAAGTGCTGGCA
GAGGCAATTGTACAGGAACTCCATTACTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTATATTCATTGCCACTTG
TCATTAAGCGAATATCGAGAATTCTATCGACGTCACCATGACAAACTGTTACAGACTGAAGAGTTTCAGGGAGGA
GATCCATACGAACGAGCGGTGTATACGACGTGGAGTTTGAGCTACGAGAAACTTGACGCGTCAGCAAGATCTTTG
CTCCAAATTTTCTCGTTGCTAAATCACGAAGGAATCTCGGAGAAAATGTTTGAAAAGGCGGCATTGTCTAAAAAG
CAACTCGAGGATTCCGAACTACAAAACAAAGTGACTGAGTTGTTGAACGAGCTGGGAAAACGAGGTCCAGACTGG
TCTTGGGACTTTAAGCAGCATTCATCCACTAGTACAACAGTGGAGTCCATCATTGGCCTATCAATTTCTTGGACA
TACGACAACCAGGACTACAAATATCGTCGCACGCTTTTGCAGCATATCTCCAGCTCCAGAGCCTCGGTCGATCCA
GAACAGATGGCGCCTTCGGTTTTGAGTGGTTTGGCACTTGTATACTCCGAACAGGGGCAGTGGAAGGAAGCAGAG
GTGCTTGAGGTGGTGGTGATAGAGAAGAGGAAGTTGCTGCTCGGTGATGATCATCCTGTCACACTCACGAGCATG
GCCAACCTCGCGGGCACATACAGGAACCAGGGGAAGTGGAACAAAGCAGAGGCGCTTGAGATGGTGGTGATGAAG
AAGACGAAGCGGCTGCTCGTTGATGATCATCCTGACACACTCACGAGCATGGCCAATCTTGCGGGCACATACAGG
GACCAGGAGAAGTGGAACGAAGCAGAGGCGCTTCAGGTGGTGATGATGGAGAAGACGAAGCGGCTGCTCGGTGAT
GATCATCCTGACACACTCACAAGCATGGCCAATCTTGCGACCACATACAGGGACCAGGGGAAGTGGAAAGAGGCA
GAGGCGCTTGAGGTGGTGGTGATGAAGAAGACGAAGTGGCTGCGTGATGATGATCATCCTCACACACTCACGAGC
ATGACCAATCTGGCGTCTATGTACAGGGACTAG
Transcript >AgabiH39|447800
ATGCATAGGATGTCATCTAATACAACGAACTGGGGATTCCGATCAACTTTCGAAGGACCACCTTTGAGGCTGCTT
GCGCTAGATGGCGGTGGGATTCGCGGACTTTCAGAACTACTCATCATCAAAGAAGTCATGCACAAGCTGATGTTT
GAGGAGAACGAGAAACGGGAAAAGGACGGCAAAGAACCTCTTAGCGCACCCCCGAAGCCGTGCGATTACTTCGAT
CTGATTGGTGGTACTAGTACTGGAGGGATAATTGCTTTGATGCTCGGGCGTCTCCAGATGGATGTAGACACGGCA
ATCACAAACTATGATGATCTCGCGAAACAAGTCTTCTCCGCTATGAAGCCATGGGGAGATGGAAAATTCAAAGCG
ACAACACTCGAAGCAGCCATGAAATCTGTCGTGAAGAACGTAACTGGTGATTCAGAGTCATCCTTATTAGAAGGC
GATCAAGCTAGAGTCTGCCGAACTTTCGTCTGTGCCAAGAACGCCCACAACATGGAAATTCCAGTGCTTTTCAGG
ACATACCAGTCTCGTGAAACACATATAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCAGCACCCACA
TTTTTCAAGCGCATTACAATTGGGCGGGACCAGCCCTTTATCGATGGCGGACTAGGCCGCAATAATCCGAGTCAG
GTGGTCCTGGAAGAAGCCAATGCTCTATTTGGCACTCGTCAAATCGGGTGCTTGGTGAGCATTGGTACTGGACAG
GCCGGAATAAACGAGATCAAGAAACCTGGTTTTTGGCAGCGAATCTTACCAACCGATGTCATCGATGCGTTAAGG
AGAATTACCACCGACTGCGAATCAACACACGAAGCTATGTTGCACCGTTTTTCCAAGTTGCCGAGCACCTATTTT
CGGCTAAATGTCGAGCAGGGGATGCAGGGAGTAGCGCTCTCCGAATGGGAGAAACTGAGCAATGTGGAGGCTCAT
ACAACGCAATATATGAAGAAGGAGGAGGTCACCGAGAAACTTGCCTTGTTGGTTAGTGCGATCAGAGCCCCGAGA
GGGCAGCTTCCACTCGAGCAATTCGTTACTCCTAGGCCTCCCAATGAATCGGTTCCACAAGCCAGGGAACGCAAA
CGTTGTCCGCGTCCTGTGCAACCATTTATGGGACGAGAAGAAATCCTTGATAAGATGCGCAAATATTTTGAGTTG
GGGGGTGATTCTCGACGCGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTTTCAAATTT
GTGCAAGAATCAACCTGCTTCTCCGATGTCTTCTACATTGACGCTACCAATGAACAAACTCTTCGAACAGACCTT
GAGGCCATCACTCTAGGGAATGCAGAGCGATCAGTAGATGCAAGTCTCCGTTGGCTTGCAAGCCAGCGCAAGGGA
AGCTGGCTTCTCTTCTTCGACAACGCGGACGATGTGAACTTGAAACTGAAGAAATTCATTCCTCAATCTGGAAAC
ATCCTGGTTACAACACGTAATCCAGAGCTTCGCCTTCTCTCCGCGAAAGACGGGGATGCAAAAGTTGGTGCGATG
GAGCACGAAGACGCAATAAACCTGCTGCTGGATCGGGCTCAGGCAGAAGAGAGCTATGAAAATAAAGTGCTGGCA
GAGGCAATTGTACAGGAACTCCATTACTTTGCTTTGGCTATTTCCCAAGCTGGCGCTTATATTCATTGCCACTTG
TCATTAAGCGAATATCGAGAATTCTATCGACGTCACCATGACAAACTGTTACAGACTGAAGAGTTTCAGGGAGGA
GATCCATACGAACGAGCGGTGTATACGACGTGGAGTTTGAGCTACGAGAAACTTGACGCGTCAGCAAGATCTTTG
CTCCAAATTTTCTCGTTGCTAAATCACGAAGGAATCTCGGAGAAAATGTTTGAAAAGGCGGCATTGTCTAAAAAG
CAACTCGAGGATTCCGAACTACAAAACAAAGTGACTGAGTTGTTGAACGAGCTGGGAAAACGAGGTCCAGACTGG
TCTTGGGACTTTAAGCAGCATTCATCCACTAGTACAACAGTGGAGTCCATCATTGGCCTATCAATTTCTTGGACA
TACGACAACCAGGACTACAAATATCGTCGCACGCTTTTGCAGCATATCTCCAGCTCCAGAGCCTCGGTCGATCCA
GAACAGATGGCGCCTTCGGTTTTGAGTGGTTTGGCACTTGTATACTCCGAACAGGGGCAGTGGAAGGAAGCAGAG
GTGCTTGAGGTGGTGGTGATAGAGAAGAGGAAGTTGCTGCTCGGTGATGATCATCCTGTCACACTCACGAGCATG
GCCAACCTCGCGGGCACATACAGGAACCAGGGGAAGTGGAACAAAGCAGAGGCGCTTGAGATGGTGGTGATGAAG
AAGACGAAGCGGCTGCTCGTTGATGATCATCCTGACACACTCACGAGCATGGCCAATCTTGCGGGCACATACAGG
GACCAGGAGAAGTGGAACGAAGCAGAGGCGCTTCAGGTGGTGATGATGGAGAAGACGAAGCGGCTGCTCGGTGAT
GATCATCCTGACACACTCACAAGCATGGCCAATCTTGCGACCACATACAGGGACCAGGGGAAGTGGAAAGAGGCA
GAGGCGCTTGAGGTGGTGGTGATGAAGAAGACGAAGTGGCTGCGTGATGATGATCATCCTCACACACTCACGAGC
ATGACCAATCTGGCGTCTATGTACAGGGACTAG
Gene >AgabiH39|447800
ATGCATAGGATGTCATCTAATACAACGAACTGGGGATTCCGATCAACGTTCGGGGCCCCCTTTTGCTTCTCAACA
ACCAGTTATCACAGCAAACAGTACTAGGCCTTTCCGTGAGAAAGTTTCGGTGCGTGCATGCAGCATGTCATATCT
CATAGCCTCTCCTTGGTCTTAACAATGACTTCTTCTGCAGAAGGACCACCTTTGAGGCTGCTTGCGCTAGGTATA
TGCGTCCGTTTGCGCTCTCTCACCAATAGAGTCGCTAACTAGTAAACTCTGAACAGATGGCGGTGGGATTCGCGG
ACTTTCAGAACTACTCATCATCAAAGAAGTCATGCACAAGCTGATGTTTGAGGAGAACGAGAAACGGGAAAAGGA
CGGCAAAGAACCTCTTAGCGCACCCCCGAAGCCGTGCGATTACTTCGATCTGATTGGTGGTACTAGTACTGGAGG
GTGCGCTGCGTTATACACCTACAATCGTCTCATGTTACTCACATGTATATTGCAGGATAATTGCTTTGATGCTCG
GGCGTCTCCAGATGGATGTAGACACGGCAATCACAAACTATGATGATCTCGCGAAACAAGTCTTCTCCGCTATGA
AGCCATGGGGAGATGGAAAATTCAAAGCGACAACACTCGAAGCAGCCATGAAATCTGTCGTGAAGAACGTAACTG
GTGATTCAGAGTCATCCTTATTAGAAGGCGATCAAGCTAGAGTCTGCCGAACGTGAGTATATTGCTTACTCTTCT
GCATTTGGACTTTGAATTCAAAGATTTACTAGTTTCGTCTGTGCCAAGAACGCCCACAACATGGAAATTCCAGTG
CTTTTCAGGACATACCAGTCTCGTGAAACACATATAAATTGCAAGATTTGGGAGGCCGCTCGAGCGACATCTGCA
GCACCCACATTTTTCAAGCGCATTACAATTGGGCGGGACCAGCCCTTTATCGATGGCGGACTAGGCCGCAATAAT
CCGAGTCAGGTGGTCCTGGAAGAAGCCAATGCTCTATTTGGCACTCGTCAAATCGGGTGCTTGGTGAGCATTGGT
ACTGGACAGGCCGGAATAAACGAGATCAAGAAACCTGGTTTTTGGCAGCGAATCTTACCAACCGATGTCATCGAT
GCGTTAAGGAGAATTACCACCGACTGCGAATCAACACACGAAGCTATGTTGCACCGTTTTTCCAAGTTGCCGAGC
ACCTATTTTCGGCTAAATGTCGAGCAGGGGATGCAGGGAGTAGCGCTCTCCGAATGGGAGAAACTGAGCAATGTG
GAGGCTCATACAACGCAATATATGAAGAAGGAGGAGGTCACCGAGAAACTTGCCTTGTTGGTTAGTGCGATCAGA
GCCCCGAGAGGGCAGCTTCCACTCGAGCAATTCGGTACGGAAGAATCACTCTTGTGGATCTTCATAGTAACCTAA
TCTCGTTACCCTAGTTACTCCTAGGCCTCCCAATGAATCGGTTCCACAAGCCAGGGAACGCAAACGTTGTCCGCG
TCCTGTGCAACCATTTATGGGACGAGAAGAAATCCTTGATAAGATGCGCAAATATTTTGAGTTGGGGGGTGATTC
TCGACGCGTCTTCGTTTTGCATGGCCTTGGGGGTTCCGGCAAGACCCAAATTGCTTTCAAATTTGTGCAAGAATC
AACCTGGTATGATCCTACTCTCTACAAATTCGCGACTGGCGACAGTTTACATGTTTAATTTCCAGCTTCTCCGAT
GTCTTCTACATTGACGCTACCAATGAACAAACTCTTCGAACAGACCTTGAGGCCATCACTCTAGGGAATGCAGAG
CGATCAGTAGATGCAAGTCTCCGTTGGCTTGCAAGCCAGCGCAAGGGAAGCTGGCTTCTCTTCTTCGACAACGCG
GACGATGTGAACTTGAAACTGAAGAAATTCATTCCTCAATCTGGAAACATCCTGGTTACAACACGTAATCCAGAG
CTTCGCCTTCTCTCCGCGAAAGACGGGGATGCAAAAGTTGGTGCGATGGAGCACGAAGACGCAATAAACCTGCTG
CTGGATCGGGCTCAGGCAGAAGAGAGCTATGAAAATAAAGTGCTGGCAGAGGCAATTGTACAGGTTCTTCCTCTC
ATTTTCGTTTCTTTAGAAAACACTTTCAGTCTAAAGCACGAGACAGGAACTCCATTACTTTGCTTTGGCTATTTC
CCAAGCTGGCGCTTATATTCATTGCCACTTGTCATTAAGCGAATATCGAGAATTCTATCGACGTCACCATGACAA
ACTGTTACAGACTGAAGAGTTTCAGGGAGGAGATCCATACGAACGAGCGGTGTATACGACGTGGAGTTTGAGCTA
CGAGAAACTTGACGCGTCAGCAAGATCTTTGCTCCAAATTTTCTCGTTGCTAAATCACGAAGGAATCTCGGAGAA
AATGTTTGAAAAGGCGGCATTGTCTAAAAAGCAACTCGAGGATTCCGAACTACAAAACAAAGTGACTGAGTTGTT
GAACGAGCTGGGAAAACGAGGTCCAGACTGGTCTTGGGACTTTAAGCAGGTCACCAAGCGCCTTCGTTCATACTC
GCTCATTGAATATGATGCTCAAAATCGCACCTACAGCATTCATCCACTAGTACAACAGTGGAGTCGTACCACCAT
GGAAGGAAACAGGCAGCTCATGCAGAAATGTGTACTCAGCATCATTGGCCTATCAATTTCTTGGACATACGACAA
CCAGGACTACAAATATCGTCGCACGCTTTTGCAGCATATCTCCAGCTCCAGAGCCTCGGTCGATCCAGAACAGAT
GGCGCCTTCGGTTTTGAGTGGTTTGGCACTTGTATACTCCGAACAGGGGCAGTGGAAGGAAGCAGAGGTGCTTGA
GGTGGTGGTGATAGAGAAGAGGAAGTTGCTGCTCGGTGATGATCATCCTGTCACACTCACGAGCATGGCCAACCT
CGCGGGCACATACAGGAACCAGGGGAAGTGGAACAAAGCAGAGGCGCTTGAGATGGTGGTGATGAAGAAGACGAA
GCGGCTGCTCGTTGATGATCATCCTGACACACTCACGAGCATGGCCAATCTTGCGGGCACATACAGGGACCAGGA
GAAGTGGAACGAAGCAGAGGCGCTTCAGGTGGTGATGATGGAGAAGACGAAGCGGCTGCTCGGTGATGATCATCC
TGACACACTCACAAGCATGGCCAATCTTGCGACCACATACAGGGACCAGGGGAAGTGGAAAGAGGCAGAGGCGCT
TGAGGTGGTGGTGATGAAGAAGACGAAGTGGCTGCGTGATGATGATCATCCTCACACACTCACGAGCATGACCAA
TCTGGCGTCTATGTACAGGGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail