Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH39|435100
Gene name
Locationscaffold_08:718382..718805
Strand-
Gene length (bp)423
Transcript length (bp)423
Coding sequence length (bp)423
Protein length (aa) 141

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID1
Orthogroup9656
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|221600
Agaricus bisporus var bisporus H39 AgabiH39|285700
Agaricus bisporus var bisporus H39 AgabiH39|286900
Agaricus bisporus var bisporus H39 AgabiH39|435100 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH39|435100
MKPVVDVPPLPAKYFREEKKGPSYKQQARIEEGISIEEMLDKFGETEIKLSQKELLAMAPKLREALKDLLSKRRV
PTGENNAFEASMIEEDTKDEWLYTNVEDLGKAKKVQTVVRDKGGVRATVTEMSQVTPELKNYRGK*
Coding >AgabiH39|435100
ATGAAGCCGGTAGTGGATGTACCTCCGCTACCAGCTAAATATTTTAGAGAAGAAAAGAAGGGCCCTAGTTATAAA
CAACAGGCCAGAATCGAAGAAGGCATTAGTATCGAAGAGATGCTAGATAAATTCGGCGAAACGGAGATAAAGCTC
TCCCAGAAGGAACTACTAGCAATGGCACCTAAGTTACGCGAAGCCCTTAAGGACTTATTGAGCAAGAGAAGGGTC
CCTACAGGAGAAAATAATGCCTTCGAAGCGAGCATGATAGAGGAAGATACAAAAGATGAATGGTTATATACCAAT
GTCGAGGATCTCGGAAAAGCTAAGAAAGTGCAAACTGTAGTTCGAGACAAGGGAGGTGTTAGGGCGACTGTGACT
GAGATGTCACAGGTCACACCTGAACTTAAGAACTATAGAGGAAAGTGA
Transcript >AgabiH39|435100
ATGAAGCCGGTAGTGGATGTACCTCCGCTACCAGCTAAATATTTTAGAGAAGAAAAGAAGGGCCCTAGTTATAAA
CAACAGGCCAGAATCGAAGAAGGCATTAGTATCGAAGAGATGCTAGATAAATTCGGCGAAACGGAGATAAAGCTC
TCCCAGAAGGAACTACTAGCAATGGCACCTAAGTTACGCGAAGCCCTTAAGGACTTATTGAGCAAGAGAAGGGTC
CCTACAGGAGAAAATAATGCCTTCGAAGCGAGCATGATAGAGGAAGATACAAAAGATGAATGGTTATATACCAAT
GTCGAGGATCTCGGAAAAGCTAAGAAAGTGCAAACTGTAGTTCGAGACAAGGGAGGTGTTAGGGCGACTGTGACT
GAGATGTCACAGGTCACACCTGAACTTAAGAACTATAGAGGAAAGTGA
Gene >AgabiH39|435100
ATGAAGCCGGTAGTGGATGTACCTCCGCTACCAGCTAAATATTTTAGAGAAGAAAAGAAGGGCCCTAGTTATAAA
CAACAGGCCAGAATCGAAGAAGGCATTAGTATCGAAGAGATGCTAGATAAATTCGGCGAAACGGAGATAAAGCTC
TCCCAGAAGGAACTACTAGCAATGGCACCTAAGTTACGCGAAGCCCTTAAGGACTTATTGAGCAAGAGAAGGGTC
CCTACAGGAGAAAATAATGCCTTCGAAGCGAGCATGATAGAGGAAGATACAAAAGATGAATGGTTATATACCAAT
GTCGAGGATCTCGGAAAAGCTAAGAAAGTGCAAACTGTAGTTCGAGACAAGGGAGGTGTTAGGGCGACTGTGACT
GAGATGTCACAGGTCACACCTGAACTTAAGAACTATAGAGGAAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail